Gene: FOXO1 - Homo sapiens
Last modified: Dec 09, 2014. Release 1 • Page created: Jun 02, 2024
Summary
Gene Symbol | : | FOXO1 | ||||||||||||||||
NCBI Gene ID | : | 2308 | ||||||||||||||||
Species | : | Homo sapiens | ||||||||||||||||
Gene Synonyms | : | FKH1 | FKHR | forkhead box O1 | FORKHEAD BOX O1A | forkhead box protein O1 | forkhead box protein O1A | forkhead homolog in rhabdomyosarcoma | FORKHEAD IN RHABDOMYOSARCOMA | FORKHEAD, DROSOPHILA, HOMOLOG OF, IN RHABDOMYOSARCOMA | forkhead, Drosophila, homolog of, in rhabdomyosarcoma | FOXO1 | FOXO1A Source: GPSDB |
||||||||||||||||
Gene Homologs | : | FOXO1 (Bos taurus) | FOXO1 (Canis lupus familiaris) | FOXO1 (Homo sapiens) | FOXO1 (Macaca mulatta) | Foxo1 (Mus musculus) | FOXO1 (Pan troglodytes) | Foxo1 (Rattus norvegicus) | foxo1a (Danio rerio) | foxo1b (Danio rerio) | ||||||||||||||||
Ageing Relevance Analysis | : |
|
||||||||||||||||
Ageing Factor Stable ID | : | AF_000276 | ||||||||||||||||
Download | : | XML |
Protein Information
Protein Name | Species | UniProt Accession Number | UniProt Entry Name | Protein Function | Sequence |
---|---|---|---|---|---|
Forkhead box protein O1 | Homo sapiens | Q12778 (UniProtKB/Swiss-Prot) | FOXO1_HUMAN (UniProtKB/Swiss-Prot) | Transcription factor which acts as a regulator of cell responses to oxidative stress. In the presence of KIRT1, mediates down-regulation of cyclin D1 and up-regulation of CDKN1B levels which are required for cell transition from proliferative growth to quiescence (By similarity). Triggers death of postmitotic neurons when phosphorylated by CDK1. Activates transcription of PMAIP1. | View |
Observations
Ageing Phenotype
Data Type 1
Ageing Relevance:
- yes (Exp. Analysis)
- yes, but no ageing factor assigned (Exp. Analysis)
- no (Exp. Analysis)
- putative (Comp. Analysis)
# | Observation Stable ID | Species | Gene | Other Ageing Factor | Description | PubMed | Source | ||||
---|---|---|---|---|---|---|---|---|---|---|---|
1 | OB_009885 | Homo sapiens |
|
A transcription factor of the Fox family, FOXO1 is important in development [0802]. It also appears to regulate apoptotic signals. A homologue of FOXO1A, daf-16, has been associated with ageing in roundworms [0628], and overexpression of another homologue, dFOXO, in adult fat body of fruit flies increased longevity in females [1238]. Mice overexpressing FOXO1 in skeletal muscle weighed less than controls and had a reduced skeletal muscle mass, suggesting that FOXO1 could play a role in the age-related decline in muscle mass [1467]. Results from mice also suggest that FOXO1 could be involved in type 2 diabetes [0630]. Although at present there is no evidence directly linking FOXO1 to human ageing, it remains a putative player in the human ageing process. | GenAge |
Data Type 2
no ageing phenotype observation—data type 2 available
Homology Analysis
Ageing Relevance:
- yes (Exp. Analysis)
- yes, but no ageing factor assigned (Exp. Analysis)
- no (Exp. Analysis)
- putative (Comp. Analysis)
Legend:
- #EGHG:
- Number of Experimentally Confirmed Ageing-related Genes In Homology Group
# | Observation Stable ID | Homology Group Genes | #EGHG | Description | Source | Homology Source | ||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 | OB_009023 |
|
1 | The HomoloGene homology group 1527 contains 1 gene with experimental evidence for ageing relevance (FOXO1 - Homo sapiens) and 8 other genes. | AgeFactDB Homology Analysis | HomoloGene homology group 1527 |
Sequences
FOXO1_HUMAN | Q12778 | Forkhead box protein O1 (Homo sapiens) from UniProtKB/Swiss-Prot Length: 655 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 210 220 230 240 250 260 270 280 290 300 310 320 330 340 350 360 370 380 390 400 410 420 430 440 450 460 470 480 490 500 510 520 530 540 550 560 570 580 590 600 610 620 630 640 650 FOXO1_HUMAN 1 MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPSASAAAVSADFMSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHPAPPQPPPPGPLSQHPPVPPAAAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSGQEGAGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG 655
References
MeSH Terms: Only a subset of the Medical Subject Headings terms is shown: the Major Topics MeSH terms. They describe one of the main topics discussed in the article denoted by an asterisk on the MeSH term or MeSH/Subheading combination on the PubMed page. MeSH terms that belong to the Ageing MeSH are highlighted in green.
- Ogg S, Paradis S, Gottlieb S, Patterson GI, Lee L, Tissenbaum HA, Ruvkun G:
The Fork head transcription factor DAF-16 transduces insulin-like metabolic and longevity signals in C. elegans.
Nature. 1997; 389: 994-9.
PubMed (ID: 9353126), doi:10.1038/40194
MeSH Terms: Caenorhabditis elegans Proteins; Caenorhabditis elegans/metabolism; Helminth Proteins/metabolism; Insulin/metabolism; Longevity; Phosphatidylinositol 3-Kinases; Signal Transduction; Transcription Factors/metabolism - Nakae J, Biggs WH, Kitamura T, Cavenee WK, Wright CV, Arden KC, Accili D:
Regulation of insulin action and pancreatic beta-cell function by mutated alleles of the gene encoding forkhead transcription factor Foxo1.
Nat Genet. 2002; 32: 245-53.
PubMed (ID: 12219087), doi:10.1038/ng890
MeSH Terms: Insulin/physiology; Islets of Langerhans/physiology; Transcription Factors/genetics - Furuyama T, Yamashita H, Kitayama K, Higami Y, Shimokawa I, Mori N:
Effects of aging and caloric restriction on the gene expression of Foxo1, 3, and 4 (FKHR, FKHRL1, and AFX) in the rat skeletal muscles.
Microsc Res Tech. 2002; 59: 331-4.
PubMed (ID: 12424797), doi:10.1002/jemt.10213
MeSH Terms: Aging/metabolism; Caloric Restriction; DNA-Binding Proteins/genetics; Gene Expression; Muscle, Skeletal/metabolism; Nerve Tissue Proteins; Transcription Factors/genetics - Nakae J, Kitamura T, Kitamura Y, Biggs WH, Arden KC, Accili D:
The forkhead transcription factor Foxo1 regulates adipocyte differentiation.
Dev Cell. 2003; 4: 119-29.
PubMed (ID: 12530968)
MeSH Terms: Adipocytes/cytology; Adipocytes/metabolism; Cell Differentiation; Transcription Factors/metabolism - Hsu AL, Murphy CT, Kenyon C:
Regulation of aging and age-related disease by DAF-16 and heat-shock factor.
Science. 2003; 300: 1142-5.
PubMed (ID: 12750521), doi:10.1126/science.1083701
MeSH Terms: Aging/physiology; Caenorhabditis elegans Proteins/physiology; Caenorhabditis elegans/physiology; Transcription Factors/physiology - Purdom S, Chen QM:
p66(Shc): at the crossroad of oxidative stress and the genetics of aging.
Trends Mol Med. 2003; 9: 206-10.
PubMed (ID: 12763525)
MeSH Terms: Adaptor Proteins, Signal Transducing; Aging/genetics; Oxidative Stress/physiology; Proteins/genetics - Lehmann OJ, Sowden JC, Carlsson P, Jordan T, Bhattacharya SS:
Fox's in development and disease.
Trends Genet. 2003; 19: 339-44.
PubMed (ID: 12801727), doi:10.1016/S0168-9525(03)00111-2
MeSH Terms: Anterior Eye Segment/abnormalities; DNA-Binding Proteins/genetics; Eye Abnormalities/genetics; Transcription Factors/genetics - Bonafè M, Barbieri M, Marchegiani F, Olivieri F, Ragno E, Giampieri C, Mugianesi E, Centurelli M, Franceschi C, Paolisso G:
Polymorphic variants of insulin-like growth factor I (IGF-I) receptor and phosphoinositide 3-kinase genes affect IGF-I plasma levels and human longevity: cues for an evolutionarily conserved mechanism of life span control.
J Clin Endocrinol Metab. 2003; 88: 3299-304.
PubMed (ID: 12843179)
MeSH Terms: Insulin-Like Growth Factor I/metabolism; Longevity/genetics; Phosphatidylinositol 3-Kinases/genetics; Polymorphism, Genetic; Receptor, IGF Type 1/genetics - Murphy CT, McCarroll SA, Bargmann CI, Fraser A, Kamath RS, Ahringer J, Li H, Kenyon C:
Genes that act downstream of DAF-16 to influence the lifespan of Caenorhabditis elegans.
Nature. 2003; 424: 277-83.
PubMed (ID: 12845331), doi:10.1038/nature01789
MeSH Terms: Aging/genetics; Caenorhabditis elegans Proteins/genetics; Caenorhabditis elegans Proteins/metabolism; Caenorhabditis elegans/genetics; Genes, Helminth/genetics; Longevity/genetics; Transcription Factors/metabolism - McElwee J, Bubb K, Thomas JH:
Transcriptional outputs of the Caenorhabditis elegans forkhead protein DAF-16.
Aging Cell. 2003; 2: 111-21.
PubMed (ID: 12882324)
MeSH Terms: Caenorhabditis elegans Proteins/physiology; Caenorhabditis elegans/genetics; Gene Expression Profiling; Gene Expression Regulation, Developmental; Longevity/genetics; Transcription Factors/physiology; Transcription, Genetic - Purdom S, Chen QM:
Linking oxidative stress and genetics of aging with p66Shc signaling and forkhead transcription factors.
Biogerontology. 2003; 4: 181-91.
PubMed (ID: 14501182)
MeSH Terms: Aging/genetics; Oxidative Stress; Signal Transduction; Transcription Factors/metabolism - Lin K, Dorman JB, Rodan A, Kenyon C:
daf-16: An HNF-3/forkhead family member that can function to double the life-span of Caenorhabditis elegans.
Science. 1997; 278: 1319-22.
PubMed (ID: 9360933)
MeSH Terms: Caenorhabditis elegans Proteins; Caenorhabditis elegans/genetics; Transcription Factors/genetics; Transcription Factors/physiology - Coffer P:
OutFOXing the grim reaper: novel mechanisms regulating longevity by forkhead transcription factors.
Sci STKE. 2003; 2003: PE39.
PubMed (ID: 14506287), doi:10.1126/stke.2003.201.pe39
MeSH Terms: Longevity/physiology; Nuclear Proteins/metabolism; Transcription Factors/metabolism - Maier B, Gluba W, Bernier B, Turner T, Mohammad K, Guise T, Sutherland A, Thorner M, Scrable H:
Modulation of mammalian life span by the short isoform of p53.
Genes Dev. 2004; 18: 306-19.
PubMed (ID: 14871929), PubMed Central (ID: PMC338283), doi:10.1101/gad.1162404
MeSH Terms: Genes, p53; Longevity/genetics - Antebi A:
Inside insulin signaling, communication is key to long life.
Sci Aging Knowledge Environ. 2004; 2004: pe25.
PubMed (ID: 15190176), doi:10.1126/sageke.2004.23.pe25
MeSH Terms: Insulin/physiology; Longevity/physiology - Giannakou ME, Goss M, Jünger MA, Hafen E, Leevers SJ, Partridge L:
Long-lived Drosophila with overexpressed dFOXO in adult fat body.
Science. 2004; 305: 361.
PubMed (ID: 15192154), doi:10.1126/science.1098219
MeSH Terms: Drosophila Proteins/physiology; Drosophila melanogaster/physiology; Fat Body/metabolism; Longevity; Transcription Factors/physiology - Daitoku H, Hatta M, Matsuzaki H, Aratani S, Ohshima T, Miyagishi M, Nakajima T, Fukamizu A:
Silent information regulator 2 potentiates Foxo1-mediated transcription through its deacetylase activity.
Proc Natl Acad Sci USA. 2004; 101: 10042-7.
PubMed (ID: 15220471), PubMed Central (ID: PMC454161), doi:10.1073/pnas.0400593101
MeSH Terms: Sirtuins/physiology; Transcription Factors/physiology; Transcription, Genetic - Kamei Y, Miura S, Suzuki M, Kai Y, Mizukami J, Taniguchi T, Mochida K, Hata T, Matsuda J, Aburatani H, Nishino I, Ezaki O:
Skeletal muscle FOXO1 (FKHR) transgenic mice have less skeletal muscle mass, down-regulated Type I (slow twitch/red muscle) fiber genes, and impaired glycemic control.
J Biol Chem. 2004; 279: 41114-23.
PubMed (ID: 15272020), doi:10.1074/jbc.M400674200
MeSH Terms: Muscle Fibers, Slow-Twitch/metabolism; Muscle, Skeletal/metabolism; Transcription Factors/genetics; Transcription Factors/physiology - Quarrie JK, Riabowol KT:
Murine models of life span extension.
Sci Aging Knowledge Environ. 2004; 2004: re5.
PubMed (ID: 15295107), doi:10.1126/sageke.2004.31.re5
MeSH Terms: Aging/genetics; Longevity/genetics; Models, Animal - Altomonte J, Cong L, Harbaran S, Richter A, Xu J, Meseck M, Dong HH:
Foxo1 mediates insulin action on apoC-III and triglyceride metabolism.
J Clin Invest. 2004; 114: 1493-503.
PubMed (ID: 15546000), PubMed Central (ID: PMC525736), doi:10.1172/JCI19992
MeSH Terms: Apolipoproteins C/metabolism; Insulin/metabolism; Transcription Factors/genetics; Transcription Factors/metabolism; Triglycerides/metabolism - Kojima T, Kamei H, Aizu T, Arai Y, Takayama M, Nakazawa S, Ebihara Y, Inagaki H, Masui Y, Gondo Y, Sakaki Y, Hirose N:
Association analysis between longevity in the Japanese population and polymorphic variants of genes involved in insulin and insulin-like growth factor 1 signaling pathways.
Exp Gerontol. 2004; 39: 1595-8.
PubMed (ID: 15582274), doi:10.1016/j.exger.2004.05.007
MeSH Terms: Insulin-Like Growth Factor I/genetics; Insulin/genetics; Linkage Disequilibrium; Longevity/genetics; Polymorphism, Single Nucleotide; Signal Transduction/genetics - Oh SW, Mukhopadhyay A, Svrzikapa N, Jiang F, Davis RJ, Tissenbaum HA:
JNK regulates lifespan in Caenorhabditis elegans by modulating nuclear translocation of forkhead transcription factor/DAF-16.
Proc Natl Acad Sci USA. 2005; 102: 4494-9.
PubMed (ID: 15767565), PubMed Central (ID: PMC555525), doi:10.1073/pnas.0500749102
MeSH Terms: Caenorhabditis elegans Proteins/genetics; Caenorhabditis elegans Proteins/physiology; Caenorhabditis elegans/genetics; Caenorhabditis elegans/physiology; Longevity/genetics; Longevity/physiology; Mitogen-Activated Protein Kinase 8/genetics; Mitogen-Activated Protein Kinase 8/physiology; Transcription Factors/genetics; Transcription Factors/physiology - Lakowski B, Hekimi S:
The genetics of caloric restriction in Caenorhabditis elegans.
Proc Natl Acad Sci USA. 1998; 95: 13091-6.
PubMed (ID: 9789046), PubMed Central (ID: PMC23719)
MeSH Terms: Caenorhabditis elegans/genetics; Caenorhabditis elegans/growth & development; Energy Intake/genetics; Feeding Behavior; Genes, Helminth; Mutation - Papaconstantinou J, Deford JH, Gerstner A, Hsieh CC, Boylston WH, Guigneaux MM, Flurkey K, Harrison DE:
Hepatic gene and protein expression of primary components of the IGF-I axis in long lived Snell dwarf mice.
Mech Ageing Dev. 2005; 126: 692-704.
PubMed (ID: 15888324), doi:10.1016/j.mad.2005.01.002
MeSH Terms: Gene Expression Regulation/physiology; Insulin-Like Growth Factor I/biosynthesis; Liver/physiology; Longevity/physiology; Signal Transduction/physiology - Essers MA, de Vries-Smits LM, Barker N, Polderman PE, Burgering BM, Korswagen HC:
Functional interaction between beta-catenin and FOXO in oxidative stress signaling.
Science. 2005; 308: 1181-4.
PubMed (ID: 15905404), doi:10.1126/science.1109083
MeSH Terms: Caenorhabditis elegans Proteins/metabolism; Caenorhabditis elegans/metabolism; Cytoskeletal Proteins/metabolism; Oxidative Stress; Signal Transduction; Trans-Activators/metabolism; Transcription Factors/metabolism - McColl G, Vantipalli MC, Lithgow GJ:
The C. elegans ortholog of mammalian Ku70, interacts with insulin-like signaling to modulate stress resistance and life span.
FASEB J. 2005; 19: 1716-8.
PubMed (ID: 16099946), PubMed Central (ID: PMC1400606), doi:10.1096/fj.04-2447fje
MeSH Terms: Antigens, Nuclear/physiology; Caenorhabditis elegans Proteins/chemistry; Caenorhabditis elegans Proteins/genetics; DNA-Binding Proteins/genetics; DNA-Binding Proteins/physiology; Insulin/metabolism; Longevity - Yamamoto M, Clark JD, Pastor JV, Gurnani P, Nandi A, Kurosu H, Miyoshi M, Ogawa Y, Castrillon DH, Rosenblatt KP, Kuro-o M:
Regulation of oxidative stress by the anti-aging hormone klotho.
J Biol Chem. 2005; 280: 38029-34.
PubMed (ID: 16186101), PubMed Central (ID: PMC2515369), doi:10.1074/jbc.M509039200
MeSH Terms: Membrane Proteins/genetics; Membrane Proteins/metabolism; Oxidative Stress - Greer EL, Brunet A:
FOXO transcription factors at the interface between longevity and tumor suppression.
Oncogene. 2005; 24: 7410-25.
PubMed (ID: 16288288), doi:10.1038/sj.onc.1209086
MeSH Terms: Aging/physiology; Cell Transformation, Neoplastic; Forkhead Transcription Factors/physiology; Gene Expression Regulation - Fukuyama M, Rougvie AE, Rothman JH:
C. elegans DAF-18/PTEN mediates nutrient-dependent arrest of cell cycle and growth in the germline.
Curr Biol. 2006; 16: 773-9.
PubMed (ID: 16631584), doi:10.1016/j.cub.2006.02.073
MeSH Terms: Caenorhabditis elegans Proteins/physiology; Caenorhabditis elegans/growth & development; Germ Cells/physiology - Baugh LR, Sternberg PW:
DAF-16/FOXO regulates transcription of cki-1/Cip/Kip and repression of lin-4 during C. elegans L1 arrest.
Curr Biol. 2006; 16: 780-5.
PubMed (ID: 16631585), doi:10.1016/j.cub.2006.03.021
MeSH Terms: Caenorhabditis elegans Proteins/metabolism; Caenorhabditis elegans Proteins/physiology; Caenorhabditis elegans/growth & development; Cyclin-Dependent Kinase Inhibitor Proteins/metabolism; Repressor Proteins/metabolism; Transcription Factors/physiology - Tothova Z, Kollipara R, Huntly BJ, Lee BH, Castrillon DH, Cullen DE, McDowell EP, Lazo-Kallanian S, Williams IR, Sears C, Armstrong SA, Passegué E, DePinho RA, Gilliland DG:
FoxOs are critical mediators of hematopoietic stem cell resistance to physiologic oxidative stress.
Cell. 2007; 128: 325-39.
PubMed (ID: 17254970), doi:10.1016/j.cell.2007.01.003
MeSH Terms: Blood Cells/metabolism; Cell Differentiation/genetics; Forkhead Transcription Factors/genetics; Hematopoiesis/genetics; Hematopoietic Stem Cells/metabolism; Oxidative Stress/genetics - Alcendor RR, Gao S, Zhai P, Zablocki D, Holle E, Yu X, Tian B, Wagner T, Vatner SF, Sadoshima J:
Sirt1 regulates aging and resistance to oxidative stress in the heart.
Circ Res. 2007; 100: 1512-21.
PubMed (ID: 17446436), doi:10.1161/01.RES.0000267723.65696.4a
MeSH Terms: Aging; Myocardium/metabolism; Oxidative Stress; Sirtuins/physiology - de Candia P, Blekhman R, Chabot AE, Oshlack A, Gilad Y:
A combination of genomic approaches reveals the role of FOXO1a in regulating an oxidative stress response pathway.
PLoS ONE. 2008; 3: e1670.
PubMed (ID: 18301748), PubMed Central (ID: PMC2244703), doi:10.1371/journal.pone.0001670
MeSH Terms: Carrier Proteins/genetics; Forkhead Transcription Factors/physiology; Genomics/methods; Oxidative Stress - Honda Y, Honda S:
The daf-2 gene network for longevity regulates oxidative stress resistance and Mn-superoxide dismutase gene expression in Caenorhabditis elegans.
FASEB J. 1999; 13: 1385-93.
PubMed (ID: 10428762)
MeSH Terms: Caenorhabditis elegans/physiology; Gene Expression Regulation/physiology; Longevity/genetics; Receptor, Insulin/genetics; Superoxide Dismutase/genetics - Chiba T, Kamei Y, Shimizu T, Shirasawa T, Katsumata A, Shiraishi L, Sugita S, Ogawa Y, Miura S, Ezaki O:
Overexpression of FOXO1 in skeletal muscle does not alter longevity in mice.
Mech Ageing Dev. 2009; 130: 420-8.
PubMed (ID: 19426753), doi:10.1016/j.mad.2009.04.004
MeSH Terms: Forkhead Transcription Factors/biosynthesis; Gene Expression Regulation; Longevity/physiology; Muscle Proteins/biosynthesis; Muscle, Skeletal/metabolism - Yamaza H, Komatsu T, Wakita S, Kijogi C, Park S, Hayashi H, Chiba T, Mori R, Furuyama T, Mori N, Shimokawa I:
FoxO1 is involved in the antineoplastic effect of calorie restriction.
Aging Cell. 2010; 9: 372-82.
PubMed (ID: 20222901), doi:10.1111/j.1474-9726.2010.00563.x
MeSH Terms: Caloric Restriction; Cell Transformation, Neoplastic/metabolism; Forkhead Transcription Factors/metabolism - Qiang L, Banks AS, Accili D:
Uncoupling of acetylation from phosphorylation regulates FoxO1 function independent of its subcellular localization.
J Biol Chem. 2010; 285: 27396-401.
PubMed (ID: 20519497), PubMed Central (ID: PMC2930737), doi:10.1074/jbc.M110.140228
MeSH Terms: Cell Nucleus/metabolism; Forkhead Transcription Factors/metabolism; Oxidative Stress/physiology - Xiong S, Salazar G, Patrushev N, Alexander RW:
FoxO1 mediates an autofeedback loop regulating SIRT1 expression.
J Biol Chem. 2011; 286: 5289-99.
PubMed (ID: 21149440), PubMed Central (ID: PMC3037641), doi:10.1074/jbc.M110.163667
MeSH Terms: Forkhead Transcription Factors/metabolism; Gene Expression Regulation, Enzymologic/physiology; Nerve Tissue Proteins/metabolism; Response Elements/physiology; Sirtuin 1/biosynthesis; Transcription, Genetic/physiology - Medema RH, Kops GJ, Bos JL, Burgering BM:
AFX-like Forkhead transcription factors mediate cell-cycle regulation by Ras and PKB through p27kip1.
Nature. 2000; 404: 782-7.
PubMed (ID: 10783894), doi:10.1038/35008115
MeSH Terms: Blood Proteins/physiology; Cell Cycle Proteins; Cell Cycle/physiology; Microtubule-Associated Proteins/metabolism; Protein-Serine-Threonine Kinases; Proto-Oncogene Proteins/metabolism; Transcription Factors/physiology; Tumor Suppressor Proteins; ras Proteins/metabolism - Anderson MJ, Shelton GD, Cavenee WK, Arden KC:
Embryonic expression of the tumor-associated PAX3-FKHR fusion protein interferes with the developmental functions of Pax3.
Proc Natl Acad Sci USA. 2001; 98: 1589-94.
PubMed (ID: 11171995), PubMed Central (ID: PMC29301), doi:10.1073/pnas.98.4.1589
MeSH Terms: DNA-Binding Proteins/genetics; Gene Expression Regulation, Developmental; Transcription Factors/genetics - Tissenbaum HA, Guarente L:
Increased dosage of a sir-2 gene extends lifespan in Caenorhabditis elegans.
Nature. 2001; 410: 227-30.
PubMed (ID: 11242085), doi:10.1038/35065638
MeSH Terms: Caenorhabditis elegans Proteins; Caenorhabditis elegans/physiology; Histone Deacetylases/genetics; Silent Information Regulator Proteins, Saccharomyces cerevisiae; Trans-Activators/genetics - Lin K, Hsin H, Libina N, Kenyon C:
Regulation of the Caenorhabditis elegans longevity protein DAF-16 by insulin/IGF-1 and germline signaling.
Nat Genet. 2001; 28: 139-45.
PubMed (ID: 11381260), doi:10.1038/88850
MeSH Terms: Caenorhabditis elegans Proteins; Caenorhabditis elegans/physiology; Helminth Proteins/metabolism; Insulin-Like Growth Factor I/metabolism; Signal Transduction; Transcription Factors/metabolism - Alvarez B, Martínez-A C, Burgering BM, Carrera AC:
Forkhead transcription factors contribute to execution of the mitotic programme in mammals.
Nature. 2001; 413: 744-7.
PubMed (ID: 11607034), doi:10.1038/35099574
MeSH Terms: Cyclin B/genetics; Mitosis/physiology; Nuclear Proteins/physiology; Phosphatidylinositol 3-Kinases/metabolism; Protein Kinases/genetics; Protein-Serine-Threonine Kinases; Transcription Factors/physiology
Sources
Ageing-related Data Sources
- AgeFactDB Homology Analysis
- GenAge
Additional Data Sources
- AgeFactDB Pipeline
- GPSDB
- HomoloGene
- NCBI Taxonomy
- PubMed
- UniProtKB/Swiss-Prot