Gene: GPX1 - Homo sapiens
Last modified: Dec 09, 2014. Release 1 • Page created: May 19, 2024
Summary
Gene Symbol | : | GPX1 | ||||||||||||||||
NCBI Gene ID | : | 2876 | ||||||||||||||||
Species | : | Homo sapiens | ||||||||||||||||
Gene Synonyms | : | cellular glutathione peroxidase | GLUTATHIONE PEROXIDASE | glutathione peroxidase 1 | GPx-1 | GPX1 | GPXD | GSHPx-1 | GSHPX1 Source: GPSDB |
||||||||||||||||
Gene Homologs | : | GPX1 (Bos taurus) | GPX1 (Canis lupus familiaris) | GPX1 (Homo sapiens) | GPX1 (Macaca mulatta) | Gpx1 (Mus musculus) | GPX1 (Pan troglodytes) | Gpx1 (Rattus norvegicus) | gpx1a (Danio rerio) | gpx1b (Danio rerio) | LOC100857115 (Gallus gallus) | ||||||||||||||||
Ageing Relevance Analysis | : |
|
||||||||||||||||
Ageing Factor Stable ID | : | AF_000425 | ||||||||||||||||
Download | : | XML |
Protein Information
Protein Name | Species | UniProt Accession Number | UniProt Entry Name | Protein Function | Sequence |
---|---|---|---|---|---|
Glutathione peroxidase 1 | Homo sapiens | P07203 (UniProtKB/Swiss-Prot) | GPX1_HUMAN (UniProtKB/Swiss-Prot) | Protects the hemoglobin in erythrocytes from oxidative breakdown. | View |
Observations
Ageing Phenotype
Data Type 1
Ageing Relevance:
- yes (Exp. Analysis)
- yes, but no ageing factor assigned (Exp. Analysis)
- no (Exp. Analysis)
- putative (Comp. Analysis)
# | Observation Stable ID | Species | Gene | Other Ageing Factor | Description | PubMed | Source | ||||
---|---|---|---|---|---|---|---|---|---|---|---|
1 | OB_009895 | Homo sapiens |
|
Mostly present in erythrocytes, GPX1 protects from oxidative damage. Changes in GPX1 have been reported in mice during ageing and due to caloric restriction [0243], but there is no direct evidence linking GPX1 to ageing. Mice without GPX1 are more susceptibility to oxidative stress, but do not show signs of premature ageing [0741], except for cataracts [0742]. Overexpression of GPX1 in mice results in insulin (INS) resistance and obesity [1066]. Results from transgenic mice overexpressing GPX1 in the heart suggest GPX1 could be beneficial to prevent cardiac failure [1711]. Its role, if any, in human ageing remains to be determined. | GenAge |
Data Type 2
no ageing phenotype observation—data type 2 available
Homology Analysis
Ageing Relevance:
- yes (Exp. Analysis)
- yes, but no ageing factor assigned (Exp. Analysis)
- no (Exp. Analysis)
- putative (Comp. Analysis)
Legend:
- #EGHG:
- Number of Experimentally Confirmed Ageing-related Genes In Homology Group
# | Observation Stable ID | Homology Group Genes | #EGHG | Description | Source | Homology Source | |||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 | OB_008188 |
|
1 | The HomoloGene homology group 20155 contains 1 gene with experimental evidence for ageing relevance (GPX1 - Homo sapiens) and 9 other genes. | AgeFactDB Homology Analysis | HomoloGene homology group 20155 |
Sequences
GPX1_HUMAN | P07203 | Glutathione peroxidase 1 (Homo sapiens) from UniProtKB/Swiss-Prot Length: 203 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 GPX1_HUMAN 1 MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA 203
References
MeSH Terms: Only a subset of the Medical Subject Headings terms is shown: the Major Topics MeSH terms. They describe one of the main topics discussed in the article denoted by an asterisk on the MeSH term or MeSH/Subheading combination on the PubMed page. MeSH terms that belong to the Ageing MeSH are highlighted in green.
- de Haan JB, Cristiano F, Iannello RC, Kola I:
Cu/Zn-superoxide dismutase and glutathione peroxidase during aging.
Biochem Mol Biol Int. 1995; 35: 1281-97.
PubMed (ID: 7492966)
MeSH Terms: Aging/metabolism; Catalase/metabolism; Glutathione Peroxidase/metabolism; Superoxide Dismutase/metabolism - Kwon YW, Masutani H, Nakamura H, Ishii Y, Yodoi J:
Redox regulation of cell growth and cell death.
Biol Chem. 2003; 384: 991-6.
PubMed (ID: 12956415), doi:10.1515/BC.2003.111
MeSH Terms: Apoptosis/physiology; Cell Cycle; Oxidative Stress/physiology - Brown-Borg HM, Rakoczy SG:
Growth hormone administration to long-living dwarf mice alters multiple components of the antioxidative defense system.
Mech Ageing Dev. 2003; 124: 1013-24.
PubMed (ID: 14659590)
MeSH Terms: Dwarfism/physiopathology; Growth Hormone/pharmacology; Longevity; Oxidoreductases/metabolism - de Haan JB, Bladier C, Lotfi-Miri M, Taylor J, Hutchinson P, Crack PJ, Hertzog P, Kola I:
Fibroblasts derived from Gpx1 knockout mice display senescent-like features and are susceptible to H2O2-mediated cell death.
Free Radic Biol Med. 2004; 36: 53-64.
PubMed (ID: 14732290), doi:10.1016/j.freeradbiomed.2003.10.020
MeSH Terms: Apoptosis/drug effects; Cell Aging/physiology; Gene Deletion; Glutathione Peroxidase/deficiency; Glutathione Peroxidase/genetics; Hydrogen Peroxide/pharmacology - Shiomi T, Tsutsui H, Matsusaka H, Murakami K, Hayashidani S, Ikeuchi M, Wen J, Kubota T, Utsumi H, Takeshita A:
Overexpression of glutathione peroxidase prevents left ventricular remodeling and failure after myocardial infarction in mice.
Circulation. 2004; 109: 544-9.
PubMed (ID: 14744974), doi:10.1161/01.CIR.0000109701.77059.E9
MeSH Terms: Cardiac Output, Low/prevention & control; Glutathione Peroxidase/metabolism; Myocardial Infarction/therapy; Ventricular Dysfunction, Left/prevention & control; Ventricular Remodeling - Hussain SP, Amstad P, He P, Robles A, Lupold S, Kaneko I, Ichimiya M, Sengupta S, Mechanic L, Okamura S, Hofseth LJ, Moake M, Nagashima M, Forrester KS, Harris CC:
p53-induced up-regulation of MnSOD and GPx but not catalase increases oxidative stress and apoptosis.
Cancer Res. 2004; 64: 2350-6.
PubMed (ID: 15059885)
MeSH Terms: Apoptosis/physiology; Glutathione Peroxidase/biosynthesis; Superoxide Dismutase/biosynthesis; Tumor Suppressor Protein p53/physiology - McClung JP, Roneker CA, Mu W, Lisk DJ, Langlais P, Liu F, Lei XG:
Development of insulin resistance and obesity in mice overexpressing cellular glutathione peroxidase.
Proc Natl Acad Sci USA. 2004; 101: 8852-7.
PubMed (ID: 15184668), PubMed Central (ID: PMC428436), doi:10.1073/pnas.0308096101
MeSH Terms: Glutathione Peroxidase/metabolism; Insulin Resistance/physiology; Obesity/enzymology - Brown-Borg HM, Rakoczy SG, Uthus EO:
Growth hormone alters methionine and glutathione metabolism in Ames dwarf mice.
Mech Ageing Dev. 2005; 126: 389-98.
PubMed (ID: 15664625), doi:10.1016/j.mad.2004.09.005
MeSH Terms: Glutathione/metabolism; Growth Hormone/administration & dosage; Longevity/drug effects; Methionine/metabolism; Signal Transduction/drug effects - Brown-Borg HM, Rakoczy SG:
Glutathione metabolism in long-living Ames dwarf mice.
Exp Gerontol. 2005; 40: 115-20.
PubMed (ID: 15664737), doi:10.1016/j.exger.2004.11.004
MeSH Terms: Aging/metabolism; Glutathione/metabolism; Longevity - Wolf N, Penn P, Pendergrass W, Van Remmen H, Bartke A, Rabinovitch P, Martin GM:
Age-related cataract progression in five mouse models for anti-oxidant protection or hormonal influence.
Exp Eye Res. 2005; 81: 276-85.
PubMed (ID: 16129095), doi:10.1016/j.exer.2005.01.024
MeSH Terms: Aging/pathology; Cataract/physiopathology; Oxidative Stress - Marzani B, Felzani G, Bellomo RG, Vecchiet J, Marzatico F:
Human muscle aging: ROS-mediated alterations in rectus abdominis and vastus lateralis muscles.
Exp Gerontol. 2005; 40: 959-65.
PubMed (ID: 16213688), doi:10.1016/j.exger.2005.08.010
MeSH Terms: Aging/physiology; Muscle, Skeletal/physiology; Reactive Oxygen Species/metabolism - Keogh BP, Allen RG, Pignolo R, Horton J, Tresini M, Cristofalo VJ:
Expression of hydrogen peroxide and glutathione metabolizing enzymes in human skin fibroblasts derived from donors of different ages.
J Cell Physiol. 1996; 167: 512-22.
PubMed (ID: 8655605), doi:10.1002/(SICI)1097-4652(199606)167:3<512::AID-JCP15>3.0.CO;2-5
MeSH Terms: Aging/metabolism; Catalase/metabolism; Glutathione Peroxidase/metabolism; Glutathione/metabolism; Hydrogen Peroxide/metabolism; Skin/enzymology - Sablina AA, Budanov AV, Ilyinskaya GV, Agapova LS, Kravchenko JE, Chumakov PM:
The antioxidant function of the p53 tumor suppressor.
Nat Med. 2005; 11: 1306-13.
PubMed (ID: 16286925), PubMed Central (ID: PMC2637821), doi:10.1038/nm1320
MeSH Terms: Apoptosis/physiology; DNA Damage; Gene Expression Regulation/physiology; Models, Biological; Reactive Oxygen Species/metabolism; Tumor Suppressor Protein p53/metabolism - Siqueira IR, Fochesatto C, de Andrade A, Santos M, Hagen M, Bello-Klein A, Netto CA:
Total antioxidant capacity is impaired in different structures from aged rat brain.
Int J Dev Neurosci. 2005; 23: 663-71.
PubMed (ID: 16298100), doi:10.1016/j.ijdevneu.2005.03.001
MeSH Terms: Aging/metabolism; Brain Chemistry; Brain/metabolism; Catalase/metabolism; Chromans/metabolism; Glutathione Peroxidase/metabolism; Superoxide Dismutase/metabolism - Martínez-Romero R, Cañuelo A, Martínez-Lara E, Hernández R, Del Moral ML, Pedrosa JA, Peinado MA, Siles E:
Aging affects but does not eliminate the enzymatic antioxidative response to hypoxia/reoxygenation in cerebral cortex.
Exp Gerontol. 2006; 41: 25-31.
PubMed (ID: 16260109), doi:10.1016/j.exger.2005.09.009
MeSH Terms: Aging/physiology; Cerebral Cortex/enzymology; Hypoxia, Brain/physiopathology - Son TG, Zou Y, Jung KJ, Yu BP, Ishigami A, Maruyama N, Lee J:
SMP30 deficiency causes increased oxidative stress in brain.
Mech Ageing Dev. 2006; 127: 451-7.
PubMed (ID: 16500693), doi:10.1016/j.mad.2006.01.005
MeSH Terms: Calcium-Binding Proteins/deficiency; Calcium-Binding Proteins/physiology; Oxidative Stress - Sinitsyna O, Krysanova Z, Ishchenko A, Dikalova AE, Stolyarov S, Kolosova N, Vasunina E, Nevinsky G:
Age-associated changes in oxidative damage and the activity of antioxidant enzymes in rats with inherited overgeneration of free radicals.
J Cell Mol Med. 2006; 10: 206-15.
PubMed (ID: 16563232)
MeSH Terms: Aging; Antioxidants/pharmacology; DNA Damage; Free Radicals/metabolism; Hepatocytes/enzymology; Oxidative Stress - Ehrenbrink G, Hakenhaar FS, Salomon TB, Petrucci AP, Sandri MR, Benfato MS:
Antioxidant enzymes activities and protein damage in rat brain of both sexes.
Exp Gerontol. 2006; 41: 368-71.
PubMed (ID: 16581216), doi:10.1016/j.exger.2006.02.007
MeSH Terms: Aging/physiology; Antioxidants/metabolism; Brain/enzymology; Reproduction/physiology - Soerensen M, Christensen K, Stevnsner T, Christiansen L:
The Mn-superoxide dismutase single nucleotide polymorphism rs4880 and the glutathione peroxidase 1 single nucleotide polymorphism rs1050450 are associated with aging and longevity in the oldest old.
Mech Ageing Dev. 2009; 130: 308-14.
PubMed (ID: 19428448), PubMed Central (ID: PMC2720516), doi:10.1016/j.mad.2009.01.005
MeSH Terms: Glutathione Peroxidase/genetics; Longevity/genetics; Polymorphism, Single Nucleotide; Superoxide Dismutase/genetics - Loh K, Deng H, Fukushima A, Cai X, Boivin B, Galic S, Bruce C, Shields BJ, Skiba B, Ooms LM, Stepto N, Wu B, Mitchell CA, Tonks NK, Watt MJ, Febbraio MA, Crack PJ, Andrikopoulos S, Tiganis T:
Reactive oxygen species enhance insulin sensitivity.
Cell Metab. 2009; 10: 260-72.
PubMed (ID: 19808019), PubMed Central (ID: PMC2892288), doi:10.1016/j.cmet.2009.08.009
MeSH Terms: Insulin Resistance/physiology; Insulin/metabolism; Reactive Oxygen Species/metabolism - Ho YS, Magnenat JL, Bronson RT, Cao J, Gargano M, Sugawara M, Funk CD:
Mice deficient in cellular glutathione peroxidase develop normally and show no increased sensitivity to hyperoxia.
J Biol Chem. 1997; 272: 16644-51.
PubMed (ID: 9195979)
MeSH Terms: Glutathione Peroxidase/physiology; Hyperoxia/etiology - de Haan JB, Bladier C, Griffiths P, Kelner M, O'Shea RD, Cheung NS, Bronson RT, Silvestro MJ, Wild S, Zheng SS, Beart PM, Hertzog PJ, Kola I:
Mice with a homozygous null mutation for the most abundant glutathione peroxidase, Gpx1, show increased susceptibility to the oxidative stress-inducing agents paraquat and hydrogen peroxide.
J Biol Chem. 1998; 273: 22528-36.
PubMed (ID: 9712879)
MeSH Terms: Glutathione Peroxidase/genetics; Hydrogen Peroxide/toxicity; Oxidative Stress; Paraquat/toxicity - Esposito LA, Kokoszka JE, Waymire KG, Cottrell B, MacGregor GR, Wallace DC:
Mitochondrial oxidative stress in mice lacking the glutathione peroxidase-1 gene.
Free Radic Biol Med. 2000; 28: 754-66.
PubMed (ID: 10754271), PubMed Central (ID: PMC3049813)
MeSH Terms: Glutathione Peroxidase/deficiency; Mitochondria/metabolism; Oxidative Stress - Hall DM, Sattler GL, Sattler CA, Zhang HJ, Oberley LW, Pitot HC, Kregel KC:
Aging lowers steady-state antioxidant enzyme and stress protein expression in primary hepatocytes.
J Gerontol A Biol Sci Med Sci. 2001; 56: B259-67.
PubMed (ID: 11382788)
MeSH Terms: Aging/metabolism; HSP70 Heat-Shock Proteins/metabolism; Hepatocytes/metabolism; Homeostasis/physiology; Oxidoreductases/metabolism - Reddy VN, Giblin FJ, Lin LR, Dang L, Unakar NJ, Musch DC, Boyle DL, Takemoto LJ, Ho YS, Knoernschild T, Juenemann A, Lütjen-Drecoll E:
Glutathione peroxidase-1 deficiency leads to increased nuclear light scattering, membrane damage, and cataract formation in gene-knockout mice.
Invest Ophthalmol Vis Sci. 2001; 42: 3247-55.
PubMed (ID: 11726630)
MeSH Terms: Cataract/etiology; Glutathione Peroxidase/deficiency; Lens Nucleus, Crystalline/physiopathology; Light; Scattering, Radiation - Cho CG, Kim HJ, Chung SW, Jung KJ, Shim KH, Yu BP, Yodoi J, Chung HY:
Modulation of glutathione and thioredoxin systems by calorie restriction during the aging process.
Exp Gerontol. 2003; 38: 539-48.
PubMed (ID: 12742531)
MeSH Terms: Aging/physiology; Caloric Restriction/methods; DNA-(Apurinic or Apyrimidinic Site) Lyase; Drosophila Proteins; Glutathione/metabolism; Thioredoxins/metabolism; Transcription Factors - Liu R, Liu IY, Bi X, Thompson RF, Doctrow SR, Malfroy B, Baudry M:
Reversal of age-related learning deficits and brain oxidative stress in mice with superoxide dismutase/catalase mimetics.
Proc Natl Acad Sci USA. 2003; 100: 8526-31.
PubMed (ID: 12815103), PubMed Central (ID: PMC166262), doi:10.1073/pnas.1332809100
MeSH Terms: Aging/psychology; Antioxidants/therapeutic use; Brain/metabolism; Learning Disorders/drug therapy; Memory Disorders/drug therapy; Organometallic Compounds/therapeutic use; Salicylates/therapeutic use
Sources
Ageing-related Data Sources
- AgeFactDB Homology Analysis
- GenAge
Additional Data Sources
- AgeFactDB Pipeline
- GPSDB
- HomoloGene
- NCBI Taxonomy
- PubMed
- UniProtKB/Swiss-Prot