Gene: MSRA - Homo sapiens
Last modified: Dec 09, 2014. Release 1 • Page created: Jun 02, 2024
Summary
Gene Symbol | : | MSRA | ||||||||||||||||
NCBI Gene ID | : | 4482 | ||||||||||||||||
Species | : | Homo sapiens | ||||||||||||||||
Gene Synonyms | : | cytosolic methionine-S-sulfoxide reductase | methionine sulfoxide reductase A | mitochondrial peptide methionine sulfoxide reductase | MSRA | peptide met (O) reductase | peptide Met(O) reductase | PEPTIDE METHIONINE SULFOXIDE REDUCTASE | peptide methionine sulfoxide reductase | peptide-methionine (S)-S-oxide reductase | PMSR | protein-methionine-S-oxide reductase Source: GPSDB |
||||||||||||||||
Gene Homologs | : | KLLA0A01309g (Kluyveromyces lactis) | MGG_04243 (Magnaporthe oryzae) | MRSA2 (Arabidopsis thaliana) | MSRA (Bos taurus) | MSRA (Canis lupus familiaris) | MSRA (Gallus gallus) | MSRA (Homo sapiens) | MSRA (Macaca mulatta) | Msra (Mus musculus) | MSRA (Pan troglodytes) | Msra (Rattus norvegicus) | MSRA1 (Arabidopsis thaliana) | MSRA3 (Arabidopsis thaliana) | MXR1 (Saccharomyces cerevisiae) | mxr1 (Schizosaccharomyces pombe) | NCU10029 (Neurospora crassa) | si:dkey-221h15.1 (Danio rerio) | ||||||||||||||||
Ageing Relevance Analysis | : |
|
||||||||||||||||
Ageing Factor Stable ID | : | AF_001248 | ||||||||||||||||
Download | : | XML |
Protein Information
Protein Name | Species | UniProt Accession Number | UniProt Entry Name | Protein Function | Sequence |
---|---|---|---|---|---|
Mitochondrial peptide methionine sulfoxide reductase | Homo sapiens | Q9UJ68 (UniProtKB/Swiss-Prot) | MSRA_HUMAN (UniProtKB/Swiss-Prot) | Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine. | View |
Observations
Ageing Phenotype
Data Type 1
Ageing Relevance:
- yes (Exp. Analysis)
- yes, but no ageing factor assigned (Exp. Analysis)
- no (Exp. Analysis)
- putative (Comp. Analysis)
# | Observation Stable ID | Species | Gene | Other Ageing Factor | Description | PubMed | Source | ||||
---|---|---|---|---|---|---|---|---|---|---|---|
1 | OB_009680 | Homo sapiens |
|
MSRA repairs damage resulting from oxidative stress. Results from invertebrates suggest a role for MSRA in ageing. Overexpression of a MSRA homologue in fruit flies extends lifespan [0042]. Disruption of MSRA in mice decreases longevity and, albeit not proven, might accelerate ageing [0043]. In humans, MSRA has been associated with age-related diseases, such as Alzheimer's disease [0978]. Therefore, MSRA could be involved in human ageing. | GenAge |
Data Type 2
no ageing phenotype observation—data type 2 available
Homology Analysis
Ageing Relevance:
- yes (Exp. Analysis)
- yes, but no ageing factor assigned (Exp. Analysis)
- no (Exp. Analysis)
- putative (Comp. Analysis)
Legend:
- #EGHG:
- Number of Experimentally Confirmed Ageing-related Genes In Homology Group
# | Observation Stable ID | Homology Group Genes | #EGHG | Description | Source | Homology Source |
---|---|---|---|---|---|---|
1 | OB_008947 | 3 | The HomoloGene homology group 5812 contains 3 genes with experimental evidence for ageing relevance (MSRA - Homo sapiens | MXR1 - Saccharomyces cerevisiae | Msra - Mus musculus) and 14 other genes. | AgeFactDB Homology Analysis | HomoloGene homology group 5812 |
Sequences
MSRA_HUMAN | Q9UJ68 | Mitochondrial peptide methionine sulfoxide reductase (Homo sapiens) from UniProtKB/Swiss-Prot Length: 235 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 210 220 230 MSRA_HUMAN 1 MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK 235
References
MeSH Terms: Only a subset of the Medical Subject Headings terms is shown: the Major Topics MeSH terms. They describe one of the main topics discussed in the article denoted by an asterisk on the MeSH term or MeSH/Subheading combination on the PubMed page. MeSH terms that belong to the Ageing MeSH are highlighted in green.
- Moskovitz J, Jenkins NA, Gilbert DJ, Copeland NG, Jursky F, Weissbach H, Brot N:
Chromosomal localization of the mammalian peptide-methionine sulfoxide reductase gene and its differential expression in various tissues.
Proc Natl Acad Sci USA. 1996; 93: 3205-8.
PubMed (ID: 8622914), PubMed Central (ID: PMC39583)
MeSH Terms: Chromosome Mapping; Oxidoreductases/genetics; Oxidoreductases/metabolism - Stadtman ER, Van Remmen H, Richardson A, Wehr NB, Levine RL:
Methionine oxidation and aging.
Biochim Biophys Acta. 2005; 1703: 135-40.
PubMed (ID: 15680221), doi:10.1016/j.bbapap.2004.08.010
MeSH Terms: Aging/metabolism; Methionine/metabolism - Moskovitz J:
Methionine sulfoxide reductases: ubiquitous enzymes involved in antioxidant defense, protein regulation, and prevention of aging-associated diseases.
Biochim Biophys Acta. 2005; 1703: 213-9.
PubMed (ID: 15680229), doi:10.1016/j.bbapap.2004.09.003
MeSH Terms: Aging/metabolism; Antioxidants/metabolism; Oxidoreductases/metabolism - Moskovitz J, Weissbach H, Brot N:
Cloning the expression of a mammalian gene involved in the reduction of methionine sulfoxide residues in proteins.
Proc Natl Acad Sci USA. 1996; 93: 2095-9.
PubMed (ID: 8700890), PubMed Central (ID: PMC39915)
MeSH Terms: Oxidoreductases/genetics - Gabbita SP, Aksenov MY, Lovell MA, Markesbery WR:
Decrease in peptide methionine sulfoxide reductase in Alzheimer's disease brain.
J Neurochem. 1999; 73: 1660-6.
PubMed (ID: 10501213)
MeSH Terms: Alzheimer Disease/enzymology; Brain/enzymology; Oxidoreductases/genetics; Oxidoreductases/metabolism - Petropoulos I, Mary J, Perichon M, Friguet B:
Rat peptide methionine sulphoxide reductase: cloning of the cDNA, and down-regulation of gene expression and enzyme activity during aging.
Biochem J. 2001; 355: 819-25.
PubMed (ID: 11311146), PubMed Central (ID: PMC1221799)
MeSH Terms: Aging/metabolism; Gene Expression Regulation, Enzymologic; Oxidoreductases/genetics - Moskovitz J, Bar-Noy S, Williams WM, Requena J, Berlett BS, Stadtman ER:
Methionine sulfoxide reductase (MsrA) is a regulator of antioxidant defense and lifespan in mammals.
Proc Natl Acad Sci USA. 2001; 98: 12920-5.
PubMed (ID: 11606777), PubMed Central (ID: PMC60800), doi:10.1073/pnas.231472998
MeSH Terms: Antioxidants/metabolism; Methionine/chemistry; Oxidoreductases/metabolism - Ruan H, Tang XD, Chen ML, Joiner ML, Sun G, Brot N, Weissbach H, Heinemann SH, Iverson L, Wu CF, Hoshi T, Chen ML, Joiner MA, Heinemann SH:
High-quality life extension by the enzyme peptide methionine sulfoxide reductase.
Proc Natl Acad Sci USA. 2002; 99: 2748-53.
PubMed (ID: 11867705), PubMed Central (ID: PMC122419), doi:10.1073/pnas.032671199
MeSH Terms: Longevity/physiology; Oxidoreductases/physiology - Hansel A, Kuschel L, Hehl S, Lemke C, Agricola HJ, Hoshi T, Heinemann SH:
Mitochondrial targeting of the human peptide methionine sulfoxide reductase (MSRA), an enzyme involved in the repair of oxidized proteins.
FASEB J. 2002; 16: 911-3.
PubMed (ID: 12039877), doi:10.1096/fj.01-0737fje
MeSH Terms: Mitochondria/enzymology; Oxidoreductases/metabolism; Proteins/metabolism - Koc A, Gasch AP, Rutherford JC, Kim HY, Gladyshev VN:
Methionine sulfoxide reductase regulation of yeast lifespan reveals reactive oxygen species-dependent and -independent components of aging.
Proc Natl Acad Sci USA. 2004; 101: 7999-8004.
PubMed (ID: 15141092), PubMed Central (ID: PMC419546), doi:10.1073/pnas.0307929101
MeSH Terms: Cell Aging/physiology; Oxidoreductases/metabolism; Reactive Oxygen Species/metabolism; Saccharomyces cerevisiae/cytology; Saccharomyces cerevisiae/enzymology - de Magalhães JP, Cabral JA, Magalhães D:
The influence of genes on the aging process of mice: a statistical assessment of the genetics of aging.
Genetics. 2005; 169: 265-74.
PubMed (ID: 15466429), PubMed Central (ID: PMC1448866), doi:10.1534/genetics.104.032292
MeSH Terms: Aging/physiology; Gene Expression; Genes/physiology; Mortality
Sources
Ageing-related Data Sources
- AgeFactDB Homology Analysis
- GenAge
Additional Data Sources
- AgeFactDB Pipeline
- GPSDB
- HomoloGene
- NCBI Taxonomy
- PubMed
- UniProtKB/Swiss-Prot