Gene: UCP3 - Homo sapiens
Last modified: Dec 09, 2014. Release 1 • Page created: May 19, 2024
Summary
Gene Symbol | : | UCP3 | ||||||||||||||||
NCBI Gene ID | : | 7352 | ||||||||||||||||
Species | : | Homo sapiens | ||||||||||||||||
Gene Synonyms | : | mitochondrial uncoupling protein 3 | SLC25A9 | solute carrier family 25 member 9 | UCP 3 | UCP3 | UNCOUPLING PROTEIN 3 | uncoupling protein 3 (mitochondrial, proton carrier) | Uncoupling protein-3 Source: GPSDB |
||||||||||||||||
Gene Homologs | : | PUMP2 (Arabidopsis thaliana) | ucp1 (Danio rerio) | UCP3 (Bos taurus) | UCP3 (Canis lupus familiaris) | UCP3 (Gallus gallus) | UCP3 (Homo sapiens) | UCP3 (Macaca mulatta) | Ucp3 (Mus musculus) | UCP3 (Pan troglodytes) | Ucp3 (Rattus norvegicus) | ||||||||||||||||
Ageing Relevance Analysis | : |
|
||||||||||||||||
Ageing Factor Stable ID | : | AF_001991 | ||||||||||||||||
Download | : | XML |
Protein Information
Protein Name | Species | UniProt Accession Number | UniProt Entry Name | Protein Function | Sequence |
---|---|---|---|---|---|
Mitochondrial uncoupling protein 3 | Homo sapiens | P55916 (UniProtKB/Swiss-Prot) | UCP3_HUMAN (UniProtKB/Swiss-Prot) | UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation. As a result, energy is dissipated in the form of heat. May play a role in the modulation of tissue respiratory control. Participates in thermogenesis and energy balance. | View |
Observations
Ageing Phenotype
Data Type 1
Ageing Relevance:
- yes (Exp. Analysis)
- yes, but no ageing factor assigned (Exp. Analysis)
- no (Exp. Analysis)
- putative (Comp. Analysis)
# | Observation Stable ID | Species | Gene | Other Ageing Factor | Description | PubMed | Source | ||||
---|---|---|---|---|---|---|---|---|---|---|---|
1 | OB_009813 | Homo sapiens |
|
Mitochondrial uncoupling proteins create proton leaks across the inner mitochondrial membrane to uncouple oxidative phosphorylation from ATP synthesis resulting in energy being dissipated as heat. UCP3, whose gene has two splice variants, appears thus to be involved in thermogenesis. Some results from mice suggest that UCP3 might protect against oxidative damage [1449]. Mice overexpressing UCP3 in skeletal muscle are hyperphagic and lean [1456]. UCP3-null mice were normal, though production of reactive oxygen species was increased in mitochondria [1458]. Polymorphisms in the human UCP3 gene could be related to obesity and type 2 diabetes [1459]. | GenAge |
Data Type 2
no ageing phenotype observation—data type 2 available
Homology Analysis
Ageing Relevance:
- yes (Exp. Analysis)
- yes, but no ageing factor assigned (Exp. Analysis)
- no (Exp. Analysis)
- putative (Comp. Analysis)
Legend:
- #EGHG:
- Number of Experimentally Confirmed Ageing-related Genes In Homology Group
# | Observation Stable ID | Homology Group Genes | #EGHG | Description | Source | Homology Source | |||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 | OB_008224 |
|
1 | The HomoloGene homology group 2517 contains 1 gene with experimental evidence for ageing relevance (UCP3 - Homo sapiens) and 9 other genes. | AgeFactDB Homology Analysis | HomoloGene homology group 2517 |
Sequences
UCP3_HUMAN | P55916 | Mitochondrial uncoupling protein 3 (Homo sapiens) from UniProtKB/Swiss-Prot Length: 312 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 210 220 230 240 250 260 270 280 290 300 310 UCP3_HUMAN 1 MVGLKPSDVPPTMAVKFLGAGTAACFADLVTFPLDTAKVRLQIQGENQAVQTARLVQYRGVLGTILTMVRTEGPCSPYNGLVAGLQRQMSFASIRIGLYDSVKQVYTPKGADNSSLTTRILAGCTTGAMAVTCAQPTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIAREEGVRGLWKGTLPNIMRNAIVNCAEVVTYDILKEKLLDYHLLTDNFPCHFVSAFGAGFCATVVASPVDVVKTRYMNSPPGQYFSPLDCMIKMVAQEGPTAFYKGFTPSFLRLGSWNVVMFVTYEQLKRALMKVQMLRESPF 312
References
MeSH Terms: Only a subset of the Medical Subject Headings terms is shown: the Major Topics MeSH terms. They describe one of the main topics discussed in the article denoted by an asterisk on the MeSH term or MeSH/Subheading combination on the PubMed page. MeSH terms that belong to the Ageing MeSH are highlighted in green.
- Liu Q, Bai C, Chen F, Wang R, MacDonald T, Gu M, Zhang Q, Morsy MA, Caskey CT:
Uncoupling protein-3: a muscle-specific gene upregulated by leptin in ob/ob mice.
Gene. 1998; 207: 1-7.
PubMed (ID: 9511737)
MeSH Terms: Carrier Proteins/genetics; Muscle, Skeletal/metabolism; Proteins/pharmacology - Echtay KS, Roussel D, St-Pierre J, Jekabsons MB, Cadenas S, Stuart JA, Harper JA, Roebuck SJ, Morrison A, Pickering S, Clapham JC, Brand MD:
Superoxide activates mitochondrial uncoupling proteins.
Nature. 2002; 415: 96-9.
PubMed (ID: 11780125), doi:10.1038/415096a
MeSH Terms: Carrier Proteins/metabolism; Membrane Proteins/metabolism; Membrane Transport Proteins; Mitochondria/drug effects; Mitochondria/metabolism; Mitochondrial Proteins; Superoxides/pharmacology; Uncoupling Agents/metabolism - Hesselink MK, Greenhaff PL, Constantin-Teodosiu D, Hultman E, Saris WH, Nieuwlaat R, Schaart G, Kornips E, Schrauwen P:
Increased uncoupling protein 3 content does not affect mitochondrial function in human skeletal muscle in vivo.
J Clin Invest. 2003; 111: 479-86.
PubMed (ID: 12588886), PubMed Central (ID: PMC152374), doi:10.1172/JCI16653
MeSH Terms: Carrier Proteins/metabolism; Mitochondria, Muscle/metabolism; Muscle, Skeletal/metabolism - Tonkonogi M, Fernström M, Walsh B, Ji LL, Rooyackers O, Hammarqvist F, Wernerman J, Sahlin K:
Reduced oxidative power but unchanged antioxidative capacity in skeletal muscle from aged humans.
Pflugers Arch. 2003; 446: 261-9.
PubMed (ID: 12684796), doi:10.1007/s00424-003-1044-9
MeSH Terms: Aging/metabolism; Antioxidants/metabolism; Muscle, Skeletal/metabolism; Oxygen Consumption/physiology - Son C, Hosoda K, Ishihara K, Bevilacqua L, Masuzaki H, Fushiki T, Harper ME, Nakao K:
Reduction of diet-induced obesity in transgenic mice overexpressing uncoupling protein 3 in skeletal muscle.
Diabetologia. 2004; 47: 47-54.
PubMed (ID: 14673524), doi:10.1007/s00125-003-1272-8
MeSH Terms: Carrier Proteins/genetics; Diet; Mitochondria, Muscle/metabolism; Muscle, Skeletal/metabolism; Obesity/genetics - Speakman JR, Talbot DA, Selman C, Snart S, McLaren JS, Redman P, Krol E, Jackson DM, Johnson MS, Brand MD:
Uncoupled and surviving: individual mice with high metabolism have greater mitochondrial uncoupling and live longer.
Aging Cell. 2004; 3: 87-95.
PubMed (ID: 15153176), doi:10.1111/j.1474-9728.2004.00097.x
MeSH Terms: Body Weight/physiology; Energy Metabolism/physiology; Longevity/physiology; Mitochondria/metabolism - Brand MD, Affourtit C, Esteves TC, Green K, Lambert AJ, Miwa S, Pakay JL, Parker N:
Mitochondrial superoxide: production, biological effects, and activation of uncoupling proteins.
Free Radic Biol Med. 2004; 37: 755-67.
PubMed (ID: 15304252), doi:10.1016/j.freeradbiomed.2004.05.034
MeSH Terms: Carrier Proteins/physiology; Membrane Proteins/physiology; Membrane Transport Proteins/physiology; Mitochondria/metabolism; Mitochondrial Proteins/physiology; Superoxides/metabolism - Bevilacqua L, Ramsey JJ, Hagopian K, Weindruch R, Harper ME:
Long-term caloric restriction increases UCP3 content but decreases proton leak and reactive oxygen species production in rat skeletal muscle mitochondria.
Am J Physiol Endocrinol Metab. 2005; 289: E429-38.
PubMed (ID: 15886224), doi:10.1152/ajpendo.00435.2004
MeSH Terms: Caloric Restriction; Carrier Proteins/metabolism; Mitochondria/metabolism; Muscle, Skeletal/metabolism; Reactive Oxygen Species/metabolism - Brand MD, Esteves TC:
Physiological functions of the mitochondrial uncoupling proteins UCP2 and UCP3.
Cell Metab. 2005; 2: 85-93.
PubMed (ID: 16098826), doi:10.1016/j.cmet.2005.06.002
MeSH Terms: Carrier Proteins/metabolism; Membrane Transport Proteins/metabolism; Mitochondria/metabolism; Mitochondrial Proteins/metabolism; Thermogenesis/physiology - Silva JP, Shabalina IG, Dufour E, Petrovic N, Backlund EC, Hultenby K, Wibom R, Nedergaard J, Cannon B, Larsson NG:
SOD2 overexpression: enhanced mitochondrial tolerance but absence of effect on UCP activity.
EMBO J. 2005; 24: 4061-70.
PubMed (ID: 16281056), PubMed Central (ID: PMC1356306), doi:10.1038/sj.emboj.7600866
MeSH Terms: Carrier Proteins/metabolism; Membrane Proteins/metabolism; Mitochondria/enzymology; Superoxide Dismutase/genetics; Uncoupling Agents/metabolism - Wolkow CA, Iser WB:
Uncoupling protein homologs may provide a link between mitochondria, metabolism and lifespan.
Ageing Res Rev. 2006; 5: 196-208.
PubMed (ID: 16707280), PubMed Central (ID: PMC2553214), doi:10.1016/j.arr.2006.03.007
MeSH Terms: Carrier Proteins/metabolism; Energy Metabolism/physiology; Longevity/physiology; Membrane Proteins/metabolism; Mitochondria/metabolism - Walder K, Norman RA, Hanson RL, Schrauwen P, Neverova M, Jenkinson CP, Easlick J, Warden CH, Pecqueur C, Raimbault S, Ricquier D, Silver MH, Shuldiner AR, Solanes G, Lowell BB, Chung WK, Leibel RL, Pratley R, Ravussin E:
Association between uncoupling protein polymorphisms (UCP2-UCP3) and energy metabolism/obesity in Pima indians.
Hum Mol Genet. 1998; 7: 1431-5.
PubMed (ID: 9700198)
MeSH Terms: Carrier Proteins/genetics; Energy Metabolism/genetics; Indians, North American/genetics; Membrane Transport Proteins; Mitochondrial Proteins; Obesity/genetics; Obesity/metabolism; Proteins/genetics - Asami DK, McDonald RB, Hagopian K, Horwitz BA, Warman D, Hsiao A, Warden C, Ramsey JJ:
Effect of aging, caloric restriction, and uncoupling protein 3 (UCP3) on mitochondrial proton leak in mice.
Exp Gerontol. 2008; 43: 1069-76.
PubMed (ID: 18852040), PubMed Central (ID: PMC2614627), doi:10.1016/j.exger.2008.09.010
MeSH Terms: Aging/physiology; Caloric Restriction/mortality; Ion Channels/metabolism; Mitochondria, Muscle/metabolism; Mitochondrial Proteins/metabolism; Reactive Oxygen Species/metabolism - McDonald RB, Walker KM, Warman DB, Griffey SM, Warden CH, Ramsey JJ, Horwitz BA:
Characterization of survival and phenotype throughout the life span in UCP2/UCP3 genetically altered mice.
Exp Gerontol. 2008; 43: 1061-8.
PubMed (ID: 18854208), doi:10.1016/j.exger.2008.09.011
MeSH Terms: Body Weight/physiology; Caloric Restriction/mortality; Ion Channels/metabolism; Longevity/physiology; Mitochondrial Proteins/metabolism; Uncoupling Agents/metabolism - Humphrey DM, Toivonen JM, Giannakou M, Partridge L, Brand MD:
Expression of human uncoupling protein-3 in Drosophila insulin-producing cells increases insulin-like peptide (DILP) levels and shortens lifespan.
Exp Gerontol. 2009; 44: 316-27.
PubMed (ID: 19385039), PubMed Central (ID: PMC2698063)
MeSH Terms: Aging/metabolism; Drosophila/metabolism; Insulin-Secreting Cells/metabolism; Ion Channels/metabolism; Mitochondrial Proteins/metabolism - Argyropoulos G, Brown AM, Willi SM, Zhu J, He Y, Reitman M, Gevao SM, Spruill I, Garvey WT:
Effects of mutations in the human uncoupling protein 3 gene on the respiratory quotient and fat oxidation in severe obesity and type 2 diabetes.
J Clin Invest. 1998; 102: 1345-51.
PubMed (ID: 9769326), PubMed Central (ID: PMC508981), doi:10.1172/JCI4115
MeSH Terms: Carrier Proteins/genetics; Diabetes Mellitus, Type 2/genetics; Diabetes Mellitus/genetics; Lipolysis/genetics; Obesity; Point Mutation; Polymorphism, Genetic - Yamashita H, Sato Y, Mori N:
Difference in induction of uncoupling protein genes in adipose tissues between young and old rats during cold exposure.
FEBS Lett. 1999; 458: 157-61.
PubMed (ID: 10481056)
MeSH Terms: Adipose Tissue/metabolism; Aging/genetics; Carrier Proteins/biosynthesis; Carrier Proteins/genetics; Cold Temperature; Gene Expression Regulation/physiology; Membrane Proteins/biosynthesis; Membrane Proteins/genetics; Membrane Transport Proteins; Mitochondria/genetics; Mitochondrial Proteins; Uncoupling Agents/metabolism - Gong DW, Monemdjou S, Gavrilova O, Leon LR, Marcus-Samuels B, Chou CJ, Everett C, Kozak LP, Li C, Deng C, Harper ME, Reitman ML:
Lack of obesity and normal response to fasting and thyroid hormone in mice lacking uncoupling protein-3.
J Biol Chem. 2000; 275: 16251-7.
PubMed (ID: 10748195), doi:10.1074/jbc.M910177199
MeSH Terms: Carrier Proteins/genetics; Obesity/genetics; Thyroid Hormones/pharmacology - Vidal-Puig AJ, Grujic D, Zhang CY, Hagen T, Boss O, Ido Y, Szczepanik A, Wade J, Mootha V, Cortright R, Muoio DM, Lowell BB:
Energy metabolism in uncoupling protein 3 gene knockout mice.
J Biol Chem. 2000; 275: 16258-66.
PubMed (ID: 10748196), doi:10.1074/jbc.M910179199
MeSH Terms: Carrier Proteins/genetics; Energy Metabolism/genetics; Membrane Transport Proteins; Mitochondrial Proteins - Clapham JC, Arch JR, Chapman H, Haynes A, Lister C, Moore GB, Piercy V, Carter SA, Lehner I, Smith SA, Beeley LJ, Godden RJ, Herrity N, Skehel M, Changani KK, Hockings PD, Reid DG, Squires SM, Hatcher J, Trail B, Latcham J, Rastan S, Harper AJ, Cadenas S, Buckingham JA, Brand MD, Abuin A:
Mice overexpressing human uncoupling protein-3 in skeletal muscle are hyperphagic and lean.
Nature. 2000; 406: 415-8.
PubMed (ID: 10935638), doi:10.1038/35019082
MeSH Terms: Carrier Proteins/physiology; Muscle, Skeletal/physiology - Scarpace PJ, Kumar MV, Li H, Tümer N:
Uncoupling proteins 2 and 3 with age: regulation by fasting and beta3-adrenergic agonist treatment.
J Gerontol A Biol Sci Med Sci. 2000; 55: B588-92.
PubMed (ID: 11129388)
MeSH Terms: Adrenergic beta-Agonists/pharmacology; Aging/metabolism; Carrier Proteins/metabolism; Dioxoles/pharmacology; Fasting/physiology; Membrane Transport Proteins; Mitochondrial Proteins; Proteins/metabolism - Barazzoni R, Nair KS:
Changes in uncoupling protein-2 and -3 expression in aging rat skeletal muscle, liver, and heart.
Am J Physiol Endocrinol Metab. 2001; 280: E413-9.
PubMed (ID: 11171595)
MeSH Terms: Aging; Carrier Proteins/genetics; Heart/growth & development; Liver/growth & development; Membrane Transport Proteins; Mitochondrial Proteins; Muscle Development; Muscle, Skeletal/growth & development; Proteins/genetics
Sources
Ageing-related Data Sources
- AgeFactDB Homology Analysis
- GenAge
Additional Data Sources
- AgeFactDB Pipeline
- GPSDB
- HomoloGene
- NCBI Taxonomy
- PubMed
- UniProtKB/Swiss-Prot