Gene: NGF - Homo sapiens
Last modified: Dec 09, 2014. Release 1 • Page created: Jun 02, 2024
Summary
Gene Symbol | : | NGF | ||||||||||||||||
NCBI Gene ID | : | 4803 | ||||||||||||||||
Species | : | Homo sapiens | ||||||||||||||||
Gene Synonyms | : | beta-nerve growth factor | Beta-NGF | HSAN5 | NERVE GROWTH FACTOR | nerve growth factor (beta polypeptide) | NERVE GROWTH FACTOR, BETA SUBUNIT | nerve growth factor, beta subunit | NGF | NGFB Source: GPSDB |
||||||||||||||||
Gene Homologs | : | LOC711681 (Macaca mulatta) | NGF (Bos taurus) | NGF (Canis lupus familiaris) | NGF (Gallus gallus) | NGF (Homo sapiens) | Ngf (Mus musculus) | NGF (Pan troglodytes) | Ngf (Rattus norvegicus) | ||||||||||||||||
Ageing Relevance Analysis | : |
|
||||||||||||||||
Ageing Factor Stable ID | : | AF_004136 | ||||||||||||||||
Download | : | XML |
Protein Information
Protein Name | Species | UniProt Accession Number | UniProt Entry Name | Protein Function | Sequence |
---|---|---|---|---|---|
Beta-nerve growth factor | Homo sapiens | P01138 (UniProtKB/Swiss-Prot) | NGF_HUMAN (UniProtKB/Swiss-Prot) | Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. | View |
Observations
Ageing Phenotype
Data Type 1
Ageing Relevance:
- yes (Exp. Analysis)
- yes, but no ageing factor assigned (Exp. Analysis)
- no (Exp. Analysis)
- putative (Comp. Analysis)
# | Observation Stable ID | Species | Gene | Other Ageing Factor | Description | PubMed | Source | ||||
---|---|---|---|---|---|---|---|---|---|---|---|
1 | OB_009694 | Homo sapiens |
|
A neurotrophin important for the development and maintenance of the central nervous system, NGF stimulates division and differentiation [0319]. It has been linked with neurodegenerative age-related pathology [0318]. | GenAge |
Data Type 2
no ageing phenotype observation—data type 2 available
Homology Analysis
Ageing Relevance:
- yes (Exp. Analysis)
- yes, but no ageing factor assigned (Exp. Analysis)
- no (Exp. Analysis)
- putative (Comp. Analysis)
Legend:
- #EGHG:
- Number of Experimentally Confirmed Ageing-related Genes In Homology Group
# | Observation Stable ID | Homology Group Genes | #EGHG | Description | Source | Homology Source | |||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 | OB_008333 |
|
1 | The HomoloGene homology group 1876 contains 1 gene with experimental evidence for ageing relevance (NGF - Homo sapiens) and 7 other genes. | AgeFactDB Homology Analysis | HomoloGene homology group 1876 |
Sequences
NGF_HUMAN | P01138 | Beta-nerve growth factor (Homo sapiens) from UniProtKB/Swiss-Prot Length: 241 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 210 220 230 240 NGF_HUMAN 1 MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA 241
References
MeSH Terms: Only a subset of the Medical Subject Headings terms is shown: the Major Topics MeSH terms. They describe one of the main topics discussed in the article denoted by an asterisk on the MeSH term or MeSH/Subheading combination on the PubMed page. MeSH terms that belong to the Ageing MeSH are highlighted in green.
- Levi-Montalcini R:
The nerve growth factor 35 years later.
Science. 1987; 237: 1154-62.
PubMed (ID: 3306916)
MeSH Terms: Nerve Growth Factors/physiology; Nervous System/embryology; Neurons/physiology - Kyng KJ, May A, Stevnsner T, Becker KG, Kølvrå S, Bohr VA:
Gene expression responses to DNA damage are altered in human aging and in Werner Syndrome.
Oncogene. 2005; 24: 5026-42.
PubMed (ID: 15897889), doi:10.1038/sj.onc.1208692
MeSH Terms: Aging/genetics; DNA Damage/genetics; Gene Expression Regulation/drug effects; Gene Expression Regulation/radiation effects; Werner Syndrome/genetics - Greer EL, Brunet A:
FOXO transcription factors at the interface between longevity and tumor suppression.
Oncogene. 2005; 24: 7410-25.
PubMed (ID: 16288288), doi:10.1038/sj.onc.1209086
MeSH Terms: Aging/physiology; Cell Transformation, Neoplastic; Forkhead Transcription Factors/physiology; Gene Expression Regulation - Jacobs WB, Govoni G, Ho D, Atwal JK, Barnabe-Heider F, Keyes WM, Mills AA, Miller FD, Kaplan DR:
p63 is an essential proapoptotic protein during neural development.
Neuron. 2005; 48: 743-56.
PubMed (ID: 16337913), doi:10.1016/j.neuron.2005.10.027
MeSH Terms: Apoptosis/physiology; Phosphoproteins/physiology; Sympathetic Nervous System/embryology; Sympathetic Nervous System/growth & development; Trans-Activators/physiology - Salehi A, Delcroix JD, Belichenko PV, Zhan K, Wu C, Valletta JS, Takimoto-Kimura R, Kleschevnikov AM, Sambamurti K, Chung PP, Xia W, Villar A, Campbell WA, Kulnane LS, Nixon RA, Lamb BT, Epstein CJ, Stokin GB, Goldstein LS, Mobley WC:
Increased App expression in a mouse model of Down's syndrome disrupts NGF transport and causes cholinergic neuron degeneration.
Neuron. 2006; 51: 29-42.
PubMed (ID: 16815330), doi:10.1016/j.neuron.2006.05.022
MeSH Terms: Alzheimer Disease/physiopathology; Amyloid beta-Protein Precursor/metabolism; Cholinergic Fibers/pathology; Down Syndrome/physiopathology; Nerve Degeneration/metabolism; Nerve Growth Factor/metabolism - Fischer W, Björklund A, Chen K, Gage FH:
NGF improves spatial memory in aged rodents as a function of age.
J Neurosci. 1991; 11: 1889-906.
PubMed (ID: 1648601)
MeSH Terms: Aging/physiology; Memory/physiology; Nerve Growth Factors/pharmacology - Alberch J, Pérez-Navarro E, Arenas E, Marsal J:
Involvement of nerve growth factor and its receptor in the regulation of the cholinergic function in aged rats.
J Neurochem. 1991; 57: 1483-7.
PubMed (ID: 1655975)
MeSH Terms: Brain/metabolism; Choline O-Acetyltransferase/metabolism; Nerve Growth Factors/physiology; Receptors, Cell Surface/physiology - Katoh-Semba R, Semba R, Kashiwamata S, Kato K:
An acceleration of age-related increases in levels of the beta-subunit of nerve growth factor in selected tissues from senescence-accelerated mice (SAM-P/8).
J Mol Neurosci. 1993; 4: 107-15.
PubMed (ID: 8217520), doi:10.1007/BF02782123
MeSH Terms: Aging/metabolism; Gene Expression Regulation; Mice, Mutant Strains/metabolism; Nerve Growth Factors/biosynthesis - Tischler AS, Riseberg JC, Hardenbrook MA, Cherington V:
Nerve growth factor is a potent inducer of proliferation and neuronal differentiation for adult rat chromaffin cells in vitro.
J Neurosci. 1993; 13: 1533-42.
PubMed (ID: 8463833)
MeSH Terms: Chromaffin System/cytology; Nerve Growth Factors/pharmacology - Brunet A, Bonni A, Zigmond MJ, Lin MZ, Juo P, Hu LS, Anderson MJ, Arden KC, Blenis J, Greenberg ME:
Akt promotes cell survival by phosphorylating and inhibiting a Forkhead transcription factor.
Cell. 1999; 96: 857-68.
PubMed (ID: 10102273)
MeSH Terms: DNA-Binding Proteins/metabolism; Protein-Serine-Threonine Kinases/metabolism; Proto-Oncogene Proteins/metabolism; Transcription Factors/metabolism; Tyrosine 3-Monooxygenase - Smith DE, Roberts J, Gage FH, Tuszynski MH:
Age-associated neuronal atrophy occurs in the primate brain and is reversible by growth factor gene therapy.
Proc Natl Acad Sci USA. 1999; 96: 10893-8.
PubMed (ID: 10485922), PubMed Central (ID: PMC17979)
MeSH Terms: Aging; Nerve Growth Factors/pharmacology; Neurodegenerative Diseases/therapy; Neurons/pathology; Prosencephalon/pathology - Ramer MS, Priestley JV, McMahon SB:
Functional regeneration of sensory axons into the adult spinal cord.
Nature. 2000; 403: 312-6.
PubMed (ID: 10659850), doi:10.1038/35002084
MeSH Terms: Axons/physiology; Nerve Growth Factors/pharmacology; Nerve Regeneration; Posterior Horn Cells/physiology; Spinal Cord/physiology; Spinal Nerve Roots/physiology - Maher FO, Martin DS, Lynch MA:
Increased IL-1beta in cortex of aged rats is accompanied by downregulation of ERK and PI-3 kinase.
Neurobiol Aging. 2004; 25: 795-806.
PubMed (ID: 15165704), doi:10.1016/j.neurobiolaging.2003.08.007
MeSH Terms: Aging/metabolism; Cerebral Cortex/metabolism; Interleukin-1/metabolism; Mitogen-Activated Protein Kinases/metabolism; Phosphatidylinositol 3-Kinases/metabolism; Receptor, trkA
Sources
Ageing-related Data Sources
- AgeFactDB Homology Analysis
- GenAge
Additional Data Sources
- AgeFactDB Pipeline
- GPSDB
- HomoloGene
- NCBI Taxonomy
- PubMed
- UniProtKB/Swiss-Prot