Release 1 - Aug 15, 2014

Browse

More lists

Gene: par-5 - Caenorhabditis elegans

Last modified: Dec 09, 2014. Release 1 • Page created: May 19, 2024
Ageing relevance by experimental analysis: yes
Defined by: NCBI Gene ID
Ageing relevance by experimental analysis: yes
Defined by: NCBI Gene ID

Summary

Gene Symbol : par-5
NCBI Gene ID : 178113
Species : Caenorhabditis elegans
Gene Synonyms : CE06200 | CELE_M117.2 | ftt-1 | M117.2 | M117.2.1 | M117.2.2 | M117.2.3 | par-5 | Protein PAR-5 | WP:CE06200
Source: [GPSDB icon]GPSDB
Gene Homologs : 14-3-3zeta (Drosophila melanogaster) | AgaP_AGAP007643 (Anopheles gambiae) | ftt-2 (Caenorhabditis elegans) | LOC100855903 (Canis lupus familiaris) | par-5 (Caenorhabditis elegans) | ywhaqa (Danio rerio) | ywhaqb (Danio rerio) | YWHAZ (Gallus gallus) | YWHAZ (Homo sapiens) | YWHAZ (Macaca mulatta) | Ywhaz (Mus musculus) | YWHAZ (Pan troglodytes) | Ywhaz (Rattus norvegicus)
Ageing Relevance Analysis :
Observation Type Count Ageing Relevance Source
Ageing Phenotype Observation—Data Type 1 1 yes (Exp. Analysis) [GenAge icon]GenAge
Ageing Phenotype Observation—Data Type 2
Lifespan Effect
increased 1 yes (Exp. Analysis) [Lifespan Observations Database icon]Lifespan Observations Database
Homology Analysis 1 - (basis for a Comp. Analysis)
putative (Comp. Analysis)		 [AgeFactDB Homology Analysis icon]AgeFactDB Homology Analysis
Total 3
Ageing Factor Stable ID : AF_005044
Download : [xml icon]XML

Protein Information

Protein Name Species UniProt Accession Number UniProt Entry Name Protein Function Sequence
14-3-3-like protein 1 Caenorhabditis elegans [UniProtKB/Swiss-Prot icon]P41932 (UniProtKB/Swiss-Prot) [UniProtKB/Swiss-Prot icon]14331_CAEEL (UniProtKB/Swiss-Prot) View

Observations

Ageing Phenotype

Data Type 1

Ageing Relevance:
  • yes (Exp. Analysis)
  • yes, but no ageing factor assigned (Exp. Analysis)
  • no (Exp. Analysis)
  • putative (Comp. Analysis)
# Observation Stable ID Species Gene Other Ageing Factor Description PubMed Source
1 OB_005688 Caenorhabditis elegans
Gene Symbol NCBI Gene ID
par-5 178113
RNA interference slightly shortens lifespan and suppresses life-extension by sir-2.1 overexpression but not by daf-2 mutants. Overexpression extends lifespan by 30%, but is suppressed by RNA interference of daf-16. 16860373 [GenAge icon]GenAge

Data Type 2

Ageing Relevance:
  • yes (Exp. Analysis)
  • yes, but no ageing factor assigned (Exp. Analysis)
  • no (Exp. Analysis)
  • putative (Comp. Analysis)
Organism Ageing Factor Lifespan Observation Reference
# Observation Stable ID Species Strain Gene Compound Other Ageing Factor Significant Lifespan Effect Change Observed Lifespan Reference Lifespan Lifespan Unit Measure Temperature Temperature Unit Sex/Mating Type Description Author Year PubMed DOI Source
1 OB_003918 Caenorhabditis elegans
Gene Symbol Species NCBI Gene ID Allele Type Allele Name Reference Allele Type Allele Change
par-5 Caenorhabditis elegans 178113 over-expression - unknown unknown
increased 30.00% Overexpression extends lifespan by 30%, but is suppressed by RNA interference of daf-16. Wang et al. 2006 16860373 [DOI icon]doi:10.1016/j.mad.2006.05.005 [Lifespan Observations Database icon]Lifespan Observations Database (ID: 632)
2 OB_005689 Caenorhabditis elegans
Gene Symbol Species NCBI Gene ID Allele Type Allele Name Reference Allele Type Allele Change
par-5 Caenorhabditis elegans 178113 Overexpression - wildtype yes
increased 30.00% unknown RNA interference slightly shortens lifespan and suppresses life-extension by sir-2.1 overexpression but not by daf-2 mutants. Overexpression extends lifespan by 30%, but is suppressed by RNA interference of daf-16. Wang et al. 2006 16860373 [DOI icon]doi:10.1016/j.mad.2006.05.005 [GenAge icon]GenAge
3 OB_003917 Caenorhabditis elegans
Gene Symbol Species NCBI Gene ID Allele Type Allele Name Reference Allele Type Allele Change
par-5 Caenorhabditis elegans 178113 RNAi knockdown - unknown unknown
increased 16.00% RNA interference shortens lifespan 16%. Other phenotypes: Suppresses life-extension by sir-2.1 overexpression but not by daf-2 mutants. Overexpression extends lifespan by 30%, but is suppressed by RNA interference of daf-16. Wang et al. 2006 16860373 [DOI icon]doi:10.1016/j.mad.2006.05.005 [Lifespan Observations Database icon]Lifespan Observations Database (ID: 631)
4 OB_005690 Caenorhabditis elegans
Gene Symbol Species NCBI Gene ID Allele Type Allele Name Reference Allele Type Allele Change
par-5 Caenorhabditis elegans 178113 RNA interference - wildtype yes
decreased -15.00% Average Post developmental RNAi let to a 15% mean lifespan reduction in wild type though no significant changes in maximal lifespan. Araiz et al. 2008 18423931 [DOI icon]doi:10.1016/j.exger.2008.03.001 [GenAge icon]GenAge

Homology Analysis

Ageing Relevance:
  • yes (Exp. Analysis)
  • yes, but no ageing factor assigned (Exp. Analysis)
  • no (Exp. Analysis)
  • putative (Comp. Analysis)
Legend:
#EGHG:
Number of Experimentally Confirmed Ageing-related Genes In Homology Group
# Observation Stable ID Homology Group Genes #EGHG Description Source Homology Source
1 OB_008896
Gene Symbol Species NCBI Gene ID
14-3-3zeta Drosophila melanogaster 36059
AgaP_AGAP007643 Anopheles gambiae 1269582
ftt-2 Caenorhabditis elegans 181348
LOC100855903 Canis lupus familiaris 100855903
par-5 Caenorhabditis elegans 178113
ywhaqa Danio rerio 399487
ywhaqb Danio rerio 335195
YWHAZ Gallus gallus 425619
YWHAZ Homo sapiens 7534
YWHAZ Macaca mulatta 709723
Ywhaz Mus musculus 22631
YWHAZ Pan troglodytes 472830
Ywhaz Rattus norvegicus 25578
3 The HomoloGene homology group 56528 contains 3 genes with experimental evidence for ageing relevance (YWHAZ - Homo sapiens | ftt-2 - Caenorhabditis elegans | par-5 - Caenorhabditis elegans) and 10 other genes. [AgeFactDB Homology Analysis icon]AgeFactDB Homology Analysis [HomoloGene icon]HomoloGene homology group 56528

Sequences

[UniProtKB/Swiss-Prot icon]14331_CAEEL | [UniProtKB/Swiss-Prot icon]P41932 | 14-3-3-like protein 1 (Caenorhabditis elegans) from UniProtKB/Swiss-Prot  Length: 248

                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240        
          14331_CAEEL     1 MSDTVEELVQRAKLAEQAERYDDMAAAMKKVTEQGQELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSEKKQQLAKEYRVKVEQELNDICQDVLKLLDEFLIVKAGAAESKVFYLKMKGDYYRYLAEVASEDRAAVVEKSQKAYQEALDIAKDKMQPTHPIRLGLALNFSVFYYEILNTPEHACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDVGAEDQEQEGNQEAGN 248

References

MeSH Terms: Only a subset of the Medical Subject Headings terms is shown: the Major Topics MeSH terms. They describe one of the main topics discussed in the article denoted by an asterisk on the MeSH term or MeSH/Subheading combination on the PubMed page. MeSH terms that belong to the Ageing MeSH are highlighted in green.

  1. Wang Y, Oh SW, Deplancke B, Luo J, Walhout AJ, Tissenbaum HA:
    C. elegans 14-3-3 proteins regulate life span and interact with SIR-2.1 and DAF-16/FOXO.
    Mech Ageing Dev. 2006; 127: 741-7.
    [PubMed icon]PubMed (ID: 16860373), [DOI icon]doi:10.1016/j.mad.2006.05.005
    MeSH Terms: 14-3-3 Proteins/physiology; Caenorhabditis elegans Proteins/metabolism; Caenorhabditis elegans Proteins/physiology; Caenorhabditis elegans/physiology; Sirtuins/metabolism; Transcription Factors/metabolism
  2. Araiz C, Château MT, Galas S:
    14-3-3 regulates life span by both DAF-16-dependent and -independent mechanisms in Caenorhabditis elegans.
    Exp Gerontol. 2008; 43: 505-19.
    [PubMed icon]PubMed (ID: 18423931), [DOI icon]doi:10.1016/j.exger.2008.03.001
    MeSH Terms: 14-3-3 Proteins/physiology; Caenorhabditis elegans Proteins/metabolism; Caenorhabditis elegans/physiology; Gene Expression Regulation, Developmental; Longevity/physiology; Receptor, Insulin/metabolism; Transcription Factors/metabolism

Sources

Ageing-related Data Sources

Additional Data Sources