Gene: mtl-1 - Caenorhabditis elegans
Last modified: Dec 09, 2014. Release 1 • Page created: May 19, 2024
Summary
Gene Symbol | : | mtl-1 | ||||||||||||
NCBI Gene ID | : | 179060 | ||||||||||||
Species | : | Caenorhabditis elegans | ||||||||||||
Gene Synonyms | : | CE07379 | CELE_K11G9.6 | K11G9.6 | met-1 | met-I | mtl-1 | Protein MTL-1 | WP:CE07379 Source: GPSDB |
||||||||||||
Gene Homologs | : | mtl-1 (Caenorhabditis elegans) | mtl-2 (Caenorhabditis elegans) | ||||||||||||
Ageing Relevance Analysis | : |
|
||||||||||||
Ageing Factor Stable ID | : | AF_005101 | ||||||||||||
Download | : | XML |
Protein Information
Protein Name | Species | UniProt Accession Number | UniProt Entry Name | Protein Function | Sequence |
---|---|---|---|---|---|
Metallothionein-1 | Caenorhabditis elegans | P17511 (UniProtKB/Swiss-Prot) | MT1_CAEEL (UniProtKB/Swiss-Prot) | This protein binds cations of several transition elements. | View |
Observations
Ageing Phenotype
Data Type 1
no ageing phenotype observation—data type 1 available
Data Type 2
no ageing phenotype observation—data type 2 available
Homology Analysis
Ageing Relevance:
- yes (Exp. Analysis)
- yes, but no ageing factor assigned (Exp. Analysis)
- no (Exp. Analysis)
- putative (Comp. Analysis)
Legend:
- #EGHG:
- Number of Experimentally Confirmed Ageing-related Genes In Homology Group
# | Observation Stable ID | Homology Group Genes | #EGHG | Description | Source | Homology Source | |||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 | OB_008184 |
|
1 | The HomoloGene homology group 119515 contains 1 gene with experimental evidence for ageing relevance (mtl-2 - Caenorhabditis elegans) and 1 other gene. | AgeFactDB Homology Analysis | HomoloGene homology group 119515 |
Sequences
MT1_CAEEL | P17511 | Metallothionein-1 (Caenorhabditis elegans) from UniProtKB/Swiss-Prot Length: 75 10 20 30 40 50 60 70 MT1_CAEEL 1 MACKCDCKNKQCKCGDKCECSGDKCCEKYCCEEASEKKCCPAGCKGDCKCANCHCAEQKQCGDKTHQHQGTAAAH 75
References
no reference information available
Sources
Ageing-related Data Sources
- AgeFactDB Homology Analysis
Additional Data Sources
- AgeFactDB Pipeline
- GPSDB
- HomoloGene
- UniProtKB/Swiss-Prot