Gene: mtl-2 - Caenorhabditis elegans
Last modified: Dec 09, 2014. Release 1 • Page created: May 19, 2024
Summary
Gene Symbol | : | mtl-2 | ||||||||||||||||||||||||
NCBI Gene ID | : | 179899 | ||||||||||||||||||||||||
Species | : | Caenorhabditis elegans | ||||||||||||||||||||||||
Gene Synonyms | : | CE25109 | CELE_T08G5.10 | met-2 | met-II | mtl-2 | Protein MTL-2 | T08G5.10 | WP:CE25109 Source: GPSDB |
||||||||||||||||||||||||
Gene Homologs | : | mtl-1 (Caenorhabditis elegans) | mtl-2 (Caenorhabditis elegans) | ||||||||||||||||||||||||
Ageing Relevance Analysis | : |
|
||||||||||||||||||||||||
Ageing Factor Stable ID | : | AF_005686 | ||||||||||||||||||||||||
Download | : | XML |
Protein Information
Protein Name | Species | UniProt Accession Number | UniProt Entry Name | Protein Function | Sequence |
---|---|---|---|---|---|
Metallothionein-2 | Caenorhabditis elegans | P17512 (UniProtKB/Swiss-Prot) | MT2_CAEEL (UniProtKB/Swiss-Prot) | This protein binds cations of several transition elements. | View |
Observations
Ageing Phenotype
Data Type 1
no ageing phenotype observation—data type 1 available
Data Type 2
Ageing Relevance:
- yes (Exp. Analysis)
- yes, but no ageing factor assigned (Exp. Analysis)
- no (Exp. Analysis)
- putative (Comp. Analysis)
Organism | Ageing Factor | Lifespan Observation | Reference | ||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
# | Observation Stable ID | Species | Strain | Gene | Compound | Other Ageing Factor | Significant Lifespan Effect | Change | Observed Lifespan | Reference Lifespan | Lifespan Unit | Measure | Temperature | Temperature Unit | Sex/Mating Type | Description | Author | Year | PubMed | DOI | Source | ||||||||||||||
1 | OB_003884 | Caenorhabditis elegans | rrf-3(pk1426) |
|
increased | 20.00% | RNA interference in rrf-3(pk1426) extends lifespan by 20% of control. | Murphy et al. | 2003 | 12845331 | doi:10.1038/nature01789 | Lifespan Observations Database (ID: 601) | |||||||||||||||||||||||
2 | OB_005592 | Caenorhabditis elegans |
|
increased | unknown | RNA interference extends lifespan. | Murphy et al. | 2003 | 12845331 | doi:10.1038/nature01789 | GenAge |
Homology Analysis
Ageing Relevance:
- yes (Exp. Analysis)
- yes, but no ageing factor assigned (Exp. Analysis)
- no (Exp. Analysis)
- putative (Comp. Analysis)
Legend:
- #EGHG:
- Number of Experimentally Confirmed Ageing-related Genes In Homology Group
# | Observation Stable ID | Homology Group Genes | #EGHG | Description | Source | Homology Source | |||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 | OB_008184 |
|
1 | The HomoloGene homology group 119515 contains 1 gene with experimental evidence for ageing relevance (mtl-2 - Caenorhabditis elegans) and 1 other gene. | AgeFactDB Homology Analysis | HomoloGene homology group 119515 |
Sequences
MT2_CAEEL | P17512 | Metallothionein-2 (Caenorhabditis elegans) from UniProtKB/Swiss-Prot Length: 63 10 20 30 40 50 60 MT2_CAEEL 1 MVCKCDCKNQNCSCNTGTKDCDCSDAKCCEQYCCPTASEKKCCKSGCAGGCKCANCECAQAAH 63
References
MeSH Terms: Only a subset of the Medical Subject Headings terms is shown: the Major Topics MeSH terms. They describe one of the main topics discussed in the article denoted by an asterisk on the MeSH term or MeSH/Subheading combination on the PubMed page. MeSH terms that belong to the Ageing MeSH are highlighted in green.
- Murphy CT, McCarroll SA, Bargmann CI, Fraser A, Kamath RS, Ahringer J, Li H, Kenyon C:
Genes that act downstream of DAF-16 to influence the lifespan of Caenorhabditis elegans.
Nature. 2003; 424: 277-83.
PubMed (ID: 12845331), doi:10.1038/nature01789
MeSH Terms: Aging/genetics; Caenorhabditis elegans Proteins/genetics; Caenorhabditis elegans Proteins/metabolism; Caenorhabditis elegans/genetics; Genes, Helminth/genetics; Longevity/genetics; Transcription Factors/metabolism
Sources
Ageing-related Data Sources
- AgeFactDB Curator
- AgeFactDB Homology Analysis
- GenAge
- Lifespan Observations Database
Additional Data Sources
- UniProtKB/Swiss-Prot
- AgeFactDB Pipeline
- GPSDB
- HomoloGene
- NCBI Taxonomy
- PubMed