Gene: baf-1 - Caenorhabditis elegans
Last modified: Dec 09, 2014. Release 1 • Page created: May 19, 2024
Summary
Gene Symbol | : | baf-1 | ||||||||||||||||||||||||||||
NCBI Gene ID | : | 176330 | ||||||||||||||||||||||||||||
Species | : | Caenorhabditis elegans | ||||||||||||||||||||||||||||
Gene Synonyms | : | 3J557 | B0464.7 | B0464.7.1 | B0464.7.2 | baf-1 | CE26704 | CELE_B0464.7 | pna-1 | Protein BAF-1 | WP:CE26704 Source: GPSDB |
||||||||||||||||||||||||||||
Gene Homologs | : | AgaP_AGAP008753 (Anopheles gambiae) | baf (Drosophila melanogaster) | baf-1 (Caenorhabditis elegans) | BANF1 (Bos taurus) | BANF1 (Canis lupus familiaris) | banf1 (Danio rerio) | BANF1 (Homo sapiens) | BANF1 (Macaca mulatta) | Banf1 (Mus musculus) | BANF1 (Pan troglodytes) | Banf1 (Rattus norvegicus) | ||||||||||||||||||||||||||||
Ageing Relevance Analysis | : |
|
||||||||||||||||||||||||||||
Ageing Factor Stable ID | : | AF_006096 | ||||||||||||||||||||||||||||
Download | : | XML |
Protein Information
Protein Name | Species | UniProt Accession Number | UniProt Entry Name | Protein Function | Sequence |
---|---|---|---|---|---|
Barrier-to-autointegration factor 1 | Caenorhabditis elegans | Q03565 (UniProtKB/Swiss-Prot) | BAF1_CAEEL (UniProtKB/Swiss-Prot) | DNA-binding protein which plays an essential role in nuclear envelope formation. Required for normal chromosome segregation during mitosis. Associates with the nuclear lamina via its interaction with LEM domain containing proteins emr-1 and lem-2. | View |
Observations
Ageing Phenotype
Data Type 1
Ageing Relevance:
- yes (Exp. Analysis)
- yes, but no ageing factor assigned (Exp. Analysis)
- no (Exp. Analysis)
- putative (Comp. Analysis)
# | Observation Stable ID | Species | Gene | Other Ageing Factor | Description | PubMed | Source | ||||
---|---|---|---|---|---|---|---|---|---|---|---|
1 | OB_005452 | Caenorhabditis elegans |
|
RNA interference decreased median lifespan by 28% in daf-2 mutants. | 18006689 | GenAge |
Data Type 2
Ageing Relevance:
- yes (Exp. Analysis)
- yes, but no ageing factor assigned (Exp. Analysis)
- no (Exp. Analysis)
- putative (Comp. Analysis)
Organism | Ageing Factor | Lifespan Observation | Reference | ||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
# | Observation Stable ID | Species | Strain | Gene | Compound | Other Ageing Factor | Significant Lifespan Effect | Change | Observed Lifespan | Reference Lifespan | Lifespan Unit | Measure | Temperature | Temperature Unit | Sex/Mating Type | Description | Author | Year | PubMed | DOI | Source | ||||||||||||||||||||||||||||
1 | OB_001828 | Caenorhabditis elegans | N2 |
|
increased | 72.79% | 25.4 | 14.7 | days | median | 25 | ℃ | hermaphrodite | A genome-wide RNAi screen was performed to identify genes necessary for the extended life span of daf-2 mutants and identified approximately 200 gene inactivations that shorten daf-2 life span. Some of these gene inactivations dramatically shorten daf-2 mutant life span but less dramatically shorten daf-2; daf-16 mutant or wild-type life span. RNAi experiments were initiated at egg. Animals were grown at 15 degrees C until L4, then transferred to 25 degrees C. | Samuelson et al. | 2007 | 18006689 | doi:10.1101/gad.1588907 | Lifespan Observations Database (ID: 3145) | ||||||||||||||||||||||||||||||
2 | OB_002177 | Caenorhabditis elegans |
|
increased | 28.00% | RNA interference decreased median lifespan by 28% in daf-2 mutants. | Samuelson et al. | 2007 | 18006689 | doi:10.1101/gad.1588907 | Lifespan Observations Database (ID: 345) | ||||||||||||||||||||||||||||||||||||||
3 | OB_002005 | Caenorhabditis elegans | N2 |
|
decreased | -31.97% | 10 | 14.7 | days | median | 25 | ℃ | hermaphrodite | A genome-wide RNAi screen was performed to identify genes necessary for the extended life span of daf-2 mutants and identified approximately 200 gene inactivations that shorten daf-2 life span. Some of these gene inactivations dramatically shorten daf-2 mutant life span but less dramatically shorten daf-2; daf-16 mutant or wild-type life span. RNAi experiments were initiated at egg. Animals were grown at 15 degrees C until L4, then transferred to 25 degrees C. | Samuelson et al. | 2007 | 18006689 | doi:10.1101/gad.1588907 | Lifespan Observations Database (ID: 3304) |
Homology Analysis
Ageing Relevance:
- yes (Exp. Analysis)
- yes, but no ageing factor assigned (Exp. Analysis)
- no (Exp. Analysis)
- putative (Comp. Analysis)
Legend:
- #EGHG:
- Number of Experimentally Confirmed Ageing-related Genes In Homology Group
# | Observation Stable ID | Homology Group Genes | #EGHG | Description | Source | Homology Source |
---|---|---|---|---|---|---|
1 | OB_009576 | 1 | The HomoloGene homology group 2866 contains 1 gene with experimental evidence for ageing relevance (baf-1 - Caenorhabditis elegans) and 10 other genes. | AgeFactDB Homology Analysis | HomoloGene homology group 2866 |
Sequences
BAF1_CAEEL | Q03565 | Barrier-to-autointegration factor 1 (Caenorhabditis elegans) from UniProtKB/Swiss-Prot Length: 89 10 20 30 40 50 60 70 80 BAF1_CAEEL 1 MSTSVKHREFVGEPMGDKEVTCIAGIGPTYGTKLTDAGFDKAYVLFGQYLLLKKDEDLFIEWLKETAGVTANHAKTAFNCLNEWADQFM 89
References
MeSH Terms: Only a subset of the Medical Subject Headings terms is shown: the Major Topics MeSH terms. They describe one of the main topics discussed in the article denoted by an asterisk on the MeSH term or MeSH/Subheading combination on the PubMed page. MeSH terms that belong to the Ageing MeSH are highlighted in green.
- Samuelson AV, Carr CE, Ruvkun G:
Gene activities that mediate increased life span of C. elegans insulin-like signaling mutants.
Genes Dev. 2007; 21: 2976-94.
PubMed (ID: 18006689), PubMed Central (ID: PMC2049198), doi:10.1101/gad.1588907
MeSH Terms: Caenorhabditis elegans/physiology; Genes, Helminth; Insulin-Like Growth Factor I/genetics; Mutation; Signal Transduction/physiology
Sources
Ageing-related Data Sources
- AgeFactDB Homology Analysis
- GenAge
- Lifespan Observations Database
Additional Data Sources
- AgeFactDB Pipeline
- GPSDB
- HomoloGene
- NCBI Taxonomy
- PubMed
- UniProtKB/Swiss-Prot