Gene: M05B5.2 - Caenorhabditis elegans
Last modified: Dec 09, 2014. Release 1 • Page created: May 19, 2024
Summary
Gene Symbol | : | M05B5.2 | ||||||||||||||||||||||||
NCBI Gene ID | : | 187451 | ||||||||||||||||||||||||
Species | : | Caenorhabditis elegans | ||||||||||||||||||||||||
Gene Synonyms | : | CELE_M05B5.2 | M05B5.2 | Protein M05B5.2 Source: GPSDB |
||||||||||||||||||||||||
Gene Homologs | : | |||||||||||||||||||||||||
Ageing Relevance Analysis | : |
|
||||||||||||||||||||||||
Ageing Factor Stable ID | : | AF_006860 | ||||||||||||||||||||||||
Download | : | XML |
Protein Information
Protein Name | Species | UniProt Accession Number | UniProt Entry Name | Protein Function | Sequence |
---|---|---|---|---|---|
Protein M05B5.2 | Caenorhabditis elegans | Q21516 (UniProtKB/TrEMBL) | Q21516_CAEEL (UniProtKB/TrEMBL) | View |
Observations
Ageing Phenotype
Data Type 1
Ageing Relevance:
- yes (Exp. Analysis)
- yes, but no ageing factor assigned (Exp. Analysis)
- no (Exp. Analysis)
- putative (Comp. Analysis)
# | Observation Stable ID | Species | Gene | Other Ageing Factor | Description | PubMed | Source | ||||
---|---|---|---|---|---|---|---|---|---|---|---|
1 | OB_005531 | Caenorhabditis elegans |
|
RNA interference decreased median lifespan by 45% in wild type animals, 46% in a daf-2 background and 44% in daf-2/daf-16 double mutants. | 18006689 | GenAge |
Data Type 2
Ageing Relevance:
- yes (Exp. Analysis)
- yes, but no ageing factor assigned (Exp. Analysis)
- no (Exp. Analysis)
- putative (Comp. Analysis)
Organism | Ageing Factor | Lifespan Observation | Reference | ||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
# | Observation Stable ID | Species | Strain | Gene | Compound | Other Ageing Factor | Significant Lifespan Effect | Change | Observed Lifespan | Reference Lifespan | Lifespan Unit | Measure | Temperature | Temperature Unit | Sex/Mating Type | Description | Author | Year | PubMed | DOI | Source | ||||||||||||||||||||||||||||
1 | OB_003865 | Caenorhabditis elegans |
|
increased | 46.00% | RNA interference decreased median lifespan by 46% in a daf-2 background. | Samuelson et al. | 2007 | 18006689 | doi:10.1101/gad.1588907 | Lifespan Observations Database (ID: 585) | ||||||||||||||||||||||||||||||||||||||
2 | OB_003864 | Caenorhabditis elegans |
|
increased | 45.00% | RNA interference decreased median lifespan by 45% in wild type animals. | Samuelson et al. | 2007 | 18006689 | doi:10.1101/gad.1588907 | Lifespan Observations Database (ID: 584) | ||||||||||||||||||||||||||||||||||||||
3 | OB_003866 | Caenorhabditis elegans |
|
increased | 44.00% | RNA interference decreased median lifespan by 44% in daf-2/daf-16 double mutants. | Samuelson et al. | 2007 | 18006689 | doi:10.1101/gad.1588907 | Lifespan Observations Database (ID: 586) | ||||||||||||||||||||||||||||||||||||||
4 | OB_001873 | Caenorhabditis elegans | N2 |
|
increased | 38.78% | 20.4 | 14.7 | days | median | 25 | ℃ | hermaphrodite | A genome-wide RNAi screen was performed to identify genes necessary for the extended life span of daf-2 mutants and identified approximately 200 gene inactivations that shorten daf-2 life span. Some of these gene inactivations dramatically shorten daf-2 mutant life span but less dramatically shorten daf-2; daf-16 mutant or wild-type life span. RNAi experiments were initiated at egg. Animals were grown at 15 degrees C until L4, then transferred to 25 degrees C. | Samuelson et al. | 2007 | 18006689 | doi:10.1101/gad.1588907 | Lifespan Observations Database (ID: 3186) | ||||||||||||||||||||||||||||||
5 | OB_001715 | Caenorhabditis elegans | N2 |
|
decreased | -44.90% | 8.1 | 14.7 | days | median | 25 | ℃ | hermaphrodite | A genome-wide RNAi screen was performed to identify genes necessary for the extended life span of daf-2 mutants and identified approximately 200 gene inactivations that shorten daf-2 life span. Some of these gene inactivations dramatically shorten daf-2 mutant life span but less dramatically shorten daf-2; daf-16 mutant or wild-type life span. RNAi experiments were initiated at egg. Animals were grown at 15 degrees C until L4, then transferred to 25 degrees C. | Samuelson et al. | 2007 | 18006689 | doi:10.1101/gad.1588907 | Lifespan Observations Database (ID: 3043) | ||||||||||||||||||||||||||||||
6 | OB_005532 | Caenorhabditis elegans |
|
decreased | -45.00% | Median | RNA interference decreased median lifespan by 45% in wild type animals, 46% in a daf-2 background and 44% in daf-2/daf-16 double mutants. | Samuelson et al. | 2007 | 18006689 | doi:10.1101/gad.1588907 | GenAge | |||||||||||||||||||||||||||||||||||||
7 | OB_001912 | Caenorhabditis elegans | N2 |
|
decreased | -62.59% | 5.5 | 14.7 | days | median | 25 | ℃ | hermaphrodite | A genome-wide RNAi screen was performed to identify genes necessary for the extended life span of daf-2 mutants and identified approximately 200 gene inactivations that shorten daf-2 life span. Some of these gene inactivations dramatically shorten daf-2 mutant life span but less dramatically shorten daf-2; daf-16 mutant or wild-type life span. RNAi experiments were initiated at egg. Animals were grown at 15 degrees C until L4, then transferred to 25 degrees C. | Samuelson et al. | 2007 | 18006689 | doi:10.1101/gad.1588907 | Lifespan Observations Database (ID: 3220) |
Homology Analysis
no homology analysis observation available
Sequences
Q21516_CAEEL | Q21516 | Protein M05B5.2 (Caenorhabditis elegans) from UniProtKB/TrEMBL Length: 128 10 20 30 40 50 60 70 80 90 100 110 120 Q21516_CAEEL 1 MEIRLRHLAFAAVLCTLCYYANGQGLNDPITQYIEGRLGNRRIFWCPSGYGYLAFCPQPTDWDNYNWCCTFPYMGSWKPSCCQFAIPTGAVVAIILAAIVLLLVLIAMSCWCCWCCPLYKQLYDFEDE 128
References
MeSH Terms: Only a subset of the Medical Subject Headings terms is shown: the Major Topics MeSH terms. They describe one of the main topics discussed in the article denoted by an asterisk on the MeSH term or MeSH/Subheading combination on the PubMed page. MeSH terms that belong to the Ageing MeSH are highlighted in green.
- Samuelson AV, Carr CE, Ruvkun G:
Gene activities that mediate increased life span of C. elegans insulin-like signaling mutants.
Genes Dev. 2007; 21: 2976-94.
PubMed (ID: 18006689), PubMed Central (ID: PMC2049198), doi:10.1101/gad.1588907
MeSH Terms: Caenorhabditis elegans/physiology; Genes, Helminth; Insulin-Like Growth Factor I/genetics; Mutation; Signal Transduction/physiology
Sources
Ageing-related Data Sources
- AgeFactDB Curator
- GenAge
- Lifespan Observations Database
Additional Data Sources
- AgeFactDB Pipeline
- GPSDB
- NCBI Taxonomy
- PubMed
- UniProtKB/TrEMBL