Gene: lsm-7 - Caenorhabditis elegans
Last modified: Dec 09, 2014. Release 1 • Page created: May 19, 2024
Summary
Gene Symbol | : | lsm-7 | ||||||||||||||||||||||||||||
NCBI Gene ID | : | 177988 | ||||||||||||||||||||||||||||
Species | : | Caenorhabditis elegans | ||||||||||||||||||||||||||||
Gene Synonyms | : | CELE_ZK593.7 | lsm-7 | Protein LSM-7 Source: GPSDB |
||||||||||||||||||||||||||||
Gene Homologs | : | AgaP_AGAP008122 (Anopheles gambiae) | AGOS_AFR053C (Eremothecium gossypii) | AT2G03870.1 (Arabidopsis thaliana) | KLLA0E22881g (Kluyveromyces lactis) | lsm-7 (Caenorhabditis elegans) | LSM7 (Bos taurus) | LSM7 (Canis lupus familiaris) | lsm7 (Danio rerio) | LSm7 (Drosophila melanogaster) | LSM7 (Gallus gallus) | LSM7 (Homo sapiens) | Lsm7 (Mus musculus) | LSM7 (Pan troglodytes) | Lsm7 (Rattus norvegicus) | LSM7 (Saccharomyces cerevisiae) | lsm7 (Schizosaccharomyces pombe) | MGG_02938 (Magnaporthe oryzae) | NCU01930 (Neurospora crassa) | Os08g0177700 (Oryza sativa) | ||||||||||||||||||||||||||||
Ageing Relevance Analysis | : |
|
||||||||||||||||||||||||||||
Ageing Factor Stable ID | : | AF_007325 | ||||||||||||||||||||||||||||
Download | : | XML |
Protein Information
Protein Name | Species | UniProt Accession Number | UniProt Entry Name | Protein Function | Sequence |
---|---|---|---|---|---|
Protein LSM-7 | Caenorhabditis elegans | Q23543 (UniProtKB/TrEMBL) | Q23543_CAEEL (UniProtKB/TrEMBL) | View |
Observations
Ageing Phenotype
Data Type 1
Ageing Relevance:
- yes (Exp. Analysis)
- yes, but no ageing factor assigned (Exp. Analysis)
- no (Exp. Analysis)
- putative (Comp. Analysis)
# | Observation Stable ID | Species | Gene | Other Ageing Factor | Description | PubMed | Source | ||||
---|---|---|---|---|---|---|---|---|---|---|---|
1 | OB_005521 | Caenorhabditis elegans |
|
RNA interference decreased median lifespan by 24% in wild type animals, 27% in a daf-2 background and 9% in daf-2/daf-16 double mutants. | 18006689 | GenAge |
Data Type 2
Ageing Relevance:
- yes (Exp. Analysis)
- yes, but no ageing factor assigned (Exp. Analysis)
- no (Exp. Analysis)
- putative (Comp. Analysis)
Organism | Ageing Factor | Lifespan Observation | Reference | ||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
# | Observation Stable ID | Species | Strain | Gene | Compound | Other Ageing Factor | Significant Lifespan Effect | Change | Observed Lifespan | Reference Lifespan | Lifespan Unit | Measure | Temperature | Temperature Unit | Sex/Mating Type | Description | Author | Year | PubMed | DOI | Source | ||||||||||||||||||||||||||||
1 | OB_001813 | Caenorhabditis elegans | N2 |
|
increased | 88.44% | 27.7 | 14.7 | days | median | 25 | ℃ | hermaphrodite | A genome-wide RNAi screen was performed to identify genes necessary for the extended life span of daf-2 mutants and identified approximately 200 gene inactivations that shorten daf-2 life span. Some of these gene inactivations dramatically shorten daf-2 mutant life span but less dramatically shorten daf-2; daf-16 mutant or wild-type life span. RNAi experiments were initiated at egg. Animals were grown at 15 degrees C until L4, then transferred to 25 degrees C. | Samuelson et al. | 2007 | 18006689 | doi:10.1101/gad.1588907 | Lifespan Observations Database (ID: 3131) | ||||||||||||||||||||||||||||||
2 | OB_003860 | Caenorhabditis elegans |
|
increased | 24.00% | RNA interference decreased median lifespan by 24% in wild type animals. | Samuelson et al. | 2007 | 18006689 | doi:10.1101/gad.1588907 | Lifespan Observations Database (ID: 580) | ||||||||||||||||||||||||||||||||||||||
3 | OB_003861 | Caenorhabditis elegans |
|
increased | 9.00% | RNA interference decreased median lifespan by 9% in daf-2/daf-16 double mutants. | Samuelson et al. | 2007 | 18006689 | doi:10.1101/gad.1588907 | Lifespan Observations Database (ID: 581) | ||||||||||||||||||||||||||||||||||||||
4 | OB_005522 | Caenorhabditis elegans |
|
decreased | -24.00% | Median | RNA interference decreased median lifespan by 24% in wild type animals, 27% in a daf-2 background and 9% in daf-2/daf-16 double mutants. | Samuelson et al. | 2007 | 18006689 | doi:10.1101/gad.1588907 | GenAge | |||||||||||||||||||||||||||||||||||||
5 | OB_001739 | Caenorhabditis elegans | N2 |
|
decreased | -24.49% | 11.1 | 14.7 | days | median | 25 | ℃ | hermaphrodite | A genome-wide RNAi screen was performed to identify genes necessary for the extended life span of daf-2 mutants and identified approximately 200 gene inactivations that shorten daf-2 life span. Some of these gene inactivations dramatically shorten daf-2 mutant life span but less dramatically shorten daf-2; daf-16 mutant or wild-type life span. RNAi experiments were initiated at egg. Animals were grown at 15 degrees C until L4, then transferred to 25 degrees C. | Samuelson et al. | 2007 | 18006689 | doi:10.1101/gad.1588907 | Lifespan Observations Database (ID: 3065) | ||||||||||||||||||||||||||||||
6 | OB_001969 | Caenorhabditis elegans | N2 |
|
decreased | -39.46% | 8.9 | 14.7 | days | median | 25 | ℃ | hermaphrodite | A genome-wide RNAi screen was performed to identify genes necessary for the extended life span of daf-2 mutants and identified approximately 200 gene inactivations that shorten daf-2 life span. Some of these gene inactivations dramatically shorten daf-2 mutant life span but less dramatically shorten daf-2; daf-16 mutant or wild-type life span. RNAi experiments were initiated at egg. Animals were grown at 15 degrees C until L4, then transferred to 25 degrees C. | Samuelson et al. | 2007 | 18006689 | doi:10.1101/gad.1588907 | Lifespan Observations Database (ID: 3272) |
Homology Analysis
Ageing Relevance:
- yes (Exp. Analysis)
- yes, but no ageing factor assigned (Exp. Analysis)
- no (Exp. Analysis)
- putative (Comp. Analysis)
Legend:
- #EGHG:
- Number of Experimentally Confirmed Ageing-related Genes In Homology Group
# | Observation Stable ID | Homology Group Genes | #EGHG | Description | Source | Homology Source |
---|---|---|---|---|---|---|
1 | OB_008410 | 1 | The HomoloGene homology group 6781 contains 1 gene with experimental evidence for ageing relevance (lsm-7 - Caenorhabditis elegans) and 18 other genes. | AgeFactDB Homology Analysis | HomoloGene homology group 6781 |
Sequences
Q23543_CAEEL | Q23543 | Protein LSM-7 (Caenorhabditis elegans) from UniProtKB/TrEMBL Length: 104 10 20 30 40 50 60 70 80 90 100 Q23543_CAEEL 1 MSKDEGKRKKESVVDLTRFLDKEIRVKFQGGREASGVLRGFDQLLNMVLDDCREYLRDPQNPSVVGDETRQLGLIVARGTAITVVSPADGLEQIANPFATQEEE 104
References
MeSH Terms: Only a subset of the Medical Subject Headings terms is shown: the Major Topics MeSH terms. They describe one of the main topics discussed in the article denoted by an asterisk on the MeSH term or MeSH/Subheading combination on the PubMed page. MeSH terms that belong to the Ageing MeSH are highlighted in green.
- Samuelson AV, Carr CE, Ruvkun G:
Gene activities that mediate increased life span of C. elegans insulin-like signaling mutants.
Genes Dev. 2007; 21: 2976-94.
PubMed (ID: 18006689), PubMed Central (ID: PMC2049198), doi:10.1101/gad.1588907
MeSH Terms: Caenorhabditis elegans/physiology; Genes, Helminth; Insulin-Like Growth Factor I/genetics; Mutation; Signal Transduction/physiology
Sources
Ageing-related Data Sources
- AgeFactDB Curator
- AgeFactDB Homology Analysis
- GenAge
- Lifespan Observations Database
Additional Data Sources
- UniProtKB/TrEMBL
- AgeFactDB Pipeline
- GPSDB
- HomoloGene
- NCBI Taxonomy
- PubMed