Gene: POU1F1 - Homo sapiens
Last modified: Dec 09, 2014. Release 1 • Page created: May 19, 2024
Summary
Gene Symbol | : | POU1F1 | ||||||||||||||||
NCBI Gene ID | : | 5449 | ||||||||||||||||
Species | : | Homo sapiens | ||||||||||||||||
Gene Synonyms | : | CPHD1 | GHF-1 | GHF1 | GROWTH HORMONE FACTOR 1 | growth hormone factor 1 | Pit-1 | PIT1 | pituitary-specific positive transcription factor 1 | PITUITARY-SPECIFIC TRANSCRIPTION FACTOR 1 | pituitary-specific transcription factor 1 | POU class 1 homeobox 1 | POU domain class 1, transcription factor 1 | POU DOMAIN, CLASS 1, TRANSCRIPTION FACTOR 1 | POU domain, class 1, transcription factor 1 | POU1F1 | POU1F1a Source: GPSDB |
||||||||||||||||
Gene Homologs | : | POU1F1 (Bos taurus) | POU1F1 (Canis lupus familiaris) | pou1f1 (Danio rerio) | POU1F1 (Gallus gallus) | POU1F1 (Homo sapiens) | POU1F1 (Macaca mulatta) | Pou1f1 (Mus musculus) | POU1F1 (Pan troglodytes) | Pou1f1 (Rattus norvegicus) | ||||||||||||||||
Ageing Relevance Analysis | : |
|
||||||||||||||||
Ageing Factor Stable ID | : | AF_008082 | ||||||||||||||||
Download | : | XML |
Protein Information
Protein Name | Species | UniProt Accession Number | UniProt Entry Name | Protein Function | Sequence |
---|---|---|---|---|---|
Pituitary-specific positive transcription factor 1 | Homo sapiens | P28069 (UniProtKB/Swiss-Prot) | PIT1_HUMAN (UniProtKB/Swiss-Prot) | Transcription factor involved in the specification of the lactotrope, somatotrope, and thyrotrope phenotypes in the developing anterior pituitary. Activates growth hormone and prolactin genes. Specifically binds to the consensus sequence 5'-TAAAT-3'. | View |
Observations
Ageing Phenotype
Data Type 1
Ageing Relevance:
- yes (Exp. Analysis)
- yes, but no ageing factor assigned (Exp. Analysis)
- no (Exp. Analysis)
- putative (Comp. Analysis)
# | Observation Stable ID | Species | Gene | Other Ageing Factor | Description | PubMed | Source | ||||
---|---|---|---|---|---|---|---|---|---|---|---|
1 | OB_009726 | Homo sapiens |
|
The POU1F1 transcription factor is expressed in the pituitary where it regulates pituitary development and hormone expression. It activates growth hormone (GH1) and is involved in mammalian development. Snell dwarf mouse are a strain mutant for POU1F1 that live significantly longer than controls and show signs of ageing retardation [0005]. POU1F1 abnormalities have been reported in humans associated with lower levels of GH1, prolactin, and thyroid-stimulating hormone, but with little or no evidence of an impact on ageing [0233]. | GenAge |
Data Type 2
no ageing phenotype observation—data type 2 available
Homology Analysis
Ageing Relevance:
- yes (Exp. Analysis)
- yes, but no ageing factor assigned (Exp. Analysis)
- no (Exp. Analysis)
- putative (Comp. Analysis)
Legend:
- #EGHG:
- Number of Experimentally Confirmed Ageing-related Genes In Homology Group
# | Observation Stable ID | Homology Group Genes | #EGHG | Description | Source | Homology Source | ||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 | OB_008233 |
|
2 | The HomoloGene homology group 259 contains 2 genes with experimental evidence for ageing relevance (POU1F1 - Homo sapiens | Pou1f1 - Mus musculus) and 7 other genes. | AgeFactDB Homology Analysis | HomoloGene homology group 259 |
Sequences
PIT1_HUMAN | P28069 | Pituitary-specific positive transcription factor 1 (Homo sapiens) from UniProtKB/Swiss-Prot Length: 291 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 210 220 230 240 250 260 270 280 290 PIT1_HUMAN 1 MSCQAFTSADTFIPLNSDASATLPLIMHHSAAECLPVSNHATNVMSTATGLHYSVPSCHYGNQPSTYGVMAGSLTPCLYKFPDHTLSHGFPPIHQPLLAEDPTAADFKQELRRKSKLVEEPIDMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFSISKEHLECR 291
References
MeSH Terms: Only a subset of the Medical Subject Headings terms is shown: the Major Topics MeSH terms. They describe one of the main topics discussed in the article denoted by an asterisk on the MeSH term or MeSH/Subheading combination on the PubMed page. MeSH terms that belong to the Ageing MeSH are highlighted in green.
- Radovick S, Nations M, Du Y, Berg LA, Weintraub BD, Wondisford FE:
A mutation in the POU-homeodomain of Pit-1 responsible for combined pituitary hormone deficiency.
Science. 1992; 257: 1115-8.
PubMed (ID: 1509262)
MeSH Terms: DNA-Binding Proteins/genetics; Mutation; Pituitary Hormones/deficiency; Transcription Factors/genetics - Madsen MA, Hsieh CC, Boylston WH, Flurkey K, Harrison D, Papaconstantinou J:
Altered oxidative stress response of the long-lived Snell dwarf mouse.
Biochem Biophys Res Commun. 2004; 318: 998-1005.
PubMed (ID: 15147972), doi:10.1016/j.bbrc.2004.04.126
MeSH Terms: Dwarfism, Pituitary/metabolism; Longevity/physiology; Mitogen-Activated Protein Kinases/metabolism; Oxidative Stress/physiology - Quarrie JK, Riabowol KT:
Murine models of life span extension.
Sci Aging Knowledge Environ. 2004; 2004: re5.
PubMed (ID: 15295107), doi:10.1126/sageke.2004.31.re5
MeSH Terms: Aging/genetics; Longevity/genetics; Models, Animal - Mobbs CV:
Not wisely but too well: aging as a cost of neuroendocrine activity.
Sci Aging Knowledge Environ. 2004; 2004: pe33.
PubMed (ID: 15342923), doi:10.1126/sageke.2004.35.pe33
MeSH Terms: Aging/physiology; Neurosecretory Systems/metabolism - Nasonkin IO, Ward RD, Raetzman LT, Seasholtz AF, Saunders TL, Gillespie PJ, Camper SA:
Pituitary hypoplasia and respiratory distress syndrome in Prop1 knockout mice.
Hum Mol Genet. 2004; 13: 2727-35.
PubMed (ID: 15459176), doi:10.1093/hmg/ddh311
MeSH Terms: Homeodomain Proteins/genetics; Pituitary Diseases/genetics; Pituitary Hormones/deficiency; Respiratory Distress Syndrome, Newborn/genetics - Holzenberger M, Kappeler L, De Magalhaes Filho C:
IGF-1 signaling and aging.
Exp Gerontol. 2004; 39: 1761-4.
PubMed (ID: 15582293), doi:10.1016/j.exger.2004.08.017
MeSH Terms: Aging/physiology; Hypothalamus/physiology; Insulin-Like Growth Factor I/metabolism; Signal Transduction/physiology - Vergara M, Smith-Wheelock M, Harper JM, Sigler R, Miller RA:
Hormone-treated snell dwarf mice regain fertility but remain long lived and disease resistant.
J Gerontol A Biol Sci Med Sci. 2004; 59: 1244-50.
PubMed (ID: 15699523), PubMed Central (ID: PMC2924623)
MeSH Terms: DNA-Binding Proteins/genetics; Dwarfism/physiopathology; Fertility; Growth Hormone/pharmacology; Longevity; Thyroxine/pharmacology; Transcription Factors/genetics - de Magalhães JP, Cabral JA, Magalhães D:
The influence of genes on the aging process of mice: a statistical assessment of the genetics of aging.
Genetics. 2005; 169: 265-74.
PubMed (ID: 15466429), PubMed Central (ID: PMC1448866), doi:10.1534/genetics.104.032292
MeSH Terms: Aging/physiology; Gene Expression; Genes/physiology; Mortality - Laron Z:
Do deficiencies in growth hormone and insulin-like growth factor-1 (IGF-1) shorten or prolong longevity?
Mech Ageing Dev. 2005; 126: 305-7.
PubMed (ID: 15621211), doi:10.1016/j.mad.2004.08.022
MeSH Terms: Aging; Growth Hormone/blood; Growth Hormone/deficiency; Growth Hormone/metabolism; Insulin-Like Growth Factor I/deficiency; Longevity - Papaconstantinou J, Deford JH, Gerstner A, Hsieh CC, Boylston WH, Guigneaux MM, Flurkey K, Harrison DE:
Hepatic gene and protein expression of primary components of the IGF-I axis in long lived Snell dwarf mice.
Mech Ageing Dev. 2005; 126: 692-704.
PubMed (ID: 15888324), doi:10.1016/j.mad.2005.01.002
MeSH Terms: Gene Expression Regulation/physiology; Insulin-Like Growth Factor I/biosynthesis; Liver/physiology; Longevity/physiology; Signal Transduction/physiology - Bartke A:
Minireview: role of the growth hormone/insulin-like growth factor system in mammalian aging.
Endocrinology. 2005; 146: 3718-23.
PubMed (ID: 15919742), doi:10.1210/en.2005-0411
MeSH Terms: Aging/physiology; Growth Hormone/physiology; Insulin-Like Growth Factor I/physiology; Longevity/physiology - Pfäffle RW, DiMattia GE, Parks JS, Brown MR, Wit JM, Jansen M, Van der Nat H, Van den Brande JL, Rosenfeld MG, Ingraham HA:
Mutation of the POU-specific domain of Pit-1 and hypopituitarism without pituitary hypoplasia.
Science. 1992; 257: 1118-21.
PubMed (ID: 1509263)
MeSH Terms: DNA-Binding Proteins/genetics; Hypopituitarism/genetics; Mutation; Pituitary Gland, Anterior/pathology; Pituitary Hormones/deficiency; Transcription Factors/genetics - Hsieh CC, Papaconstantinou J:
Thioredoxin-ASK1 complex levels regulate ROS-mediated p38 MAPK pathway activity in livers of aged and long-lived Snell dwarf mice.
FASEB J. 2006; 20: 259-68.
PubMed (ID: 16449798), PubMed Central (ID: PMC1479092), doi:10.1096/fj.05-4376com
MeSH Terms: Aging/metabolism; Liver/metabolism; MAP Kinase Kinase Kinase 5/metabolism; MAP Kinase Signaling System; Reactive Oxygen Species/metabolism; Thioredoxins/metabolism; p38 Mitogen-Activated Protein Kinases/metabolism - Andersen B, Pearse RV, Jenne K, Sornson M, Lin SC, Bartke A, Rosenfeld MG:
The Ames dwarf gene is required for Pit-1 gene activation.
Dev Biol. 1995; 172: 495-503.
PubMed (ID: 8612966)
MeSH Terms: DNA-Binding Proteins/genetics; Gene Expression Regulation, Developmental; Pituitary Gland/embryology; Transcription Factors/genetics - Tatsumi K, Amino N:
PIT1 abnormality.
Growth Horm IGF Res. 1999; 9 Suppl B: 18-22; discussion 23.
PubMed (ID: 10549301)
MeSH Terms: DNA-Binding Proteins/genetics; DNA-Binding Proteins/metabolism; Mutation; Pituitary Hormones/deficiency; Transcription Factors/genetics; Transcription Factors/metabolism - Dasen JS, Rosenfeld MG:
Signaling and transcriptional mechanisms in pituitary development.
Annu Rev Neurosci. 2001; 24: 327-55.
PubMed (ID: 11283314), doi:10.1146/annurev.neuro.24.1.327
MeSH Terms: Pituitary Gland/physiology; Signal Transduction; Transcription, Genetic - Flurkey K, Papaconstantinou J, Miller RA, Harrison DE:
Lifespan extension and delayed immune and collagen aging in mutant mice with defects in growth hormone production.
Proc Natl Acad Sci USA. 2001; 98: 6736-41.
PubMed (ID: 11371619), PubMed Central (ID: PMC34422), doi:10.1073/pnas.111158898
MeSH Terms: Aging; Collagen/chemistry; DNA-Binding Proteins/genetics; Growth Hormone/physiology; Longevity; T-Lymphocytes/physiology; Transcription Factors/genetics - Flurkey K, Papaconstantinou J, Harrison DE:
The Snell dwarf mutation Pit1(dw) can increase life span in mice.
Mech Ageing Dev. 2002; 123: 121-30.
PubMed (ID: 11718806)
MeSH Terms: DNA-Binding Proteins/genetics; Dwarfism, Pituitary/genetics; Transcription Factors/genetics - Cushman LJ, Showalter AD, Rhodes SJ:
Genetic defects in the development and function of the anterior pituitary gland.
Ann Med. 2002; 34: 179-91.
PubMed (ID: 12173688)
MeSH Terms: Hypothalamo-Hypophyseal System; Nuclear Proteins; Pituitary Gland, Anterior/physiology - Liang H, Masoro EJ, Nelson JF, Strong R, McMahan CA, Richardson A:
Genetic mouse models of extended lifespan.
Exp Gerontol. 2003; 38: 1353-64.
PubMed (ID: 14698816)
MeSH Terms: Longevity/genetics; Models, Animal; Models, Genetic
Sources
Ageing-related Data Sources
- AgeFactDB Homology Analysis
- GenAge
Additional Data Sources
- AgeFactDB Pipeline
- GPSDB
- HomoloGene
- NCBI Taxonomy
- PubMed
- UniProtKB/Swiss-Prot